Recombinant Rat Taste receptor type 2 member 124 (Tas2r124)

Shipped with Ice Packs
In Stock

Description

Key Features:

  • Amino Acid Sequence:
    The full-length sequence begins with MVSVLHSISTIIIIAEFVWGNLSN... and includes conserved residues critical for ligand binding and G protein coupling .

  • Tags: N-terminal or C-terminal 6x-His tags facilitate purification and detection .

  • Post-Translational Modifications: Produced in E. coli, it lacks glycosylation but retains structural integrity for functional assays .

Production and Purification

Recombinant Tas2r124 is synthesized in E. coli systems, ensuring high yield and cost-effectiveness .

Expression and Purification Workflow:

  1. Cloning: Full-length Tas2r124 cDNA is inserted into expression vectors .

  2. Induction: IPTG-induced expression in E. coli BL21(DE3) or similar strains .

  3. Purification: Immobilized metal affinity chromatography (IMAC) via His-tag .

  4. Quality Control: >90% purity confirmed by SDS-PAGE .

Table 2: Production Parameters Across Vendors

VendorProduct CodeExpression HostPurityForm
Creative BioMartRFL7450RFE. coli>90%Lyophilized
CusabioCSB-CF724172RAE. coli>85%Liquid/Frozen
Amerigo ScientificCustomE. coli/Yeast>90%Lyophilized

Functional Insights

Tas2r124 is implicated in bitter compound detection and GPCR signaling cascades:

  • Ligand Specificity: Binds structurally diverse bitter agonists, though exact ligands in rats remain under investigation .

  • Signaling Pathway: Couples with gustducin (Gα-gust) to activate phosphodiesterase and downstream taste transduction .

  • Extraoral Roles: Emerging evidence suggests roles in nutrient sensing and immune modulation, akin to human TAS2Rs .

Applications in Research

Recombinant Tas2r124 is utilized in:

  • Ligand Screening: Identify novel bitter compounds via calcium flux assays .

  • Structural Studies: Cryo-EM and molecular dynamics simulations (e.g., AlphaFold model AF-Q67ES5-F1) .

  • Antibody Development: Immunogen for generating anti-T2R antibodies .

Related Products and Variants

Vendors offer derivatives for specialized applications:

  • TAS2R124-5610R: His-Fc-Avi tag for surface plasmon resonance (SPR) .

  • CSB-EP724172RA1-B: Partial-length protein for epitope mapping .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Tas2r124; T2r25; Taste receptor type 2 member 124; T2R124; Taste receptor type 2 member 25; T2R25
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Tas2r124
Target Protein Sequence
MVSVLHSISTIIIIAEFVWGNLSNGLIVLKNCLDWINIKELSTLDQILILLAISRISLIW ETLLMWVKDKLISSITIEELKMIMFSFMLSSHFSLWLATALSTFYLFRIANCSWQIFLYL KWRLKHLIVQMLLGSVMFLIANIIQITITLEKRFYQYKGNTSVNSIQNEFALLIEMMLFN MTIFSVIPFLLALISFFLLIFSLWKHLQRMQLNSREDRDPSTKAHRNALGIMVSFLLLYT MYVLSLLISWIAQKNQSELVHIICMITSLLNPSVHSSILILGNFKLKQSSLCILRHLGCR LKSQNTPTT
Uniprot No.

Target Background

Function
This protein is a putative taste receptor that may play a role in the perception of bitterness.
Database Links
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Tas2r124 and what is its functional role in sensory systems?

Tas2r124 belongs to the Taste receptor type 2 (Tas2r) family, which functions as G protein-coupled receptors responsible for bitter taste sensation. Based on comparative studies with mouse models, Tas2r124 shows moderate expression levels in gustatory tissue but notably high expression in non-gustatory tissues, particularly testis . This suggests that beyond its canonical role in taste perception, Tas2r124 may serve important functions in other physiological systems, similar to what has been observed in mice where "the highest expression was observed for Tas2r113 and Tas2r124" in testicular tissue .

How does Tas2r124 expression vary across different rat tissues?

While specific rat expression data is limited in the search results, extrapolation from mouse studies suggests that Tas2r124 expression follows a tissue-specific pattern. In mice, Tas2r124 demonstrates moderate expression in gustatory tissues but high expression in testis . This differential expression pattern suggests tissue-specific regulation of the Tas2r124 gene.

To properly characterize Tas2r124 expression in rats, researchers should employ quantitative RT-PCR (qRT-PCR) across multiple tissue types, including:

  • Posterior tongue epithelium (vallate papillae)

  • Testis

  • Heart

  • Other potential tissues where bitter taste receptors might function

Expression analysis should be coupled with in situ hybridization to determine the cellular localization of Tas2r124 within each tissue, following methodologies similar to those used for mouse Tas2r studies .

What are the key structural features of recombinant rat Tas2r124?

Recombinant rat Tas2r124, like other Tas2r family members, likely features the characteristic seven-transmembrane domain structure typical of G protein-coupled receptors. When designing recombinant constructs, researchers should consider adding epitope tags (such as Rho tags) to the N-terminus to facilitate detection through immunocytochemistry protocols .

Cell surface expression is crucial for functional studies, as observed in mouse Tas2r receptors where some receptors showed clear external localization while others required cell permeabilization for detection . Researchers should verify proper trafficking of recombinant rat Tas2r124 to the cell surface using immunocytochemistry on both permeabilized and non-permeabilized cells.

How should experiments be designed to study recombinant rat Tas2r124 function?

When designing experiments to study recombinant rat Tas2r124 function, researchers should consider the following experimental design principles:

Experimental Unit Consideration:
Define whether individual transfected cells, cell populations, or animal models will serve as your experimental units. As stated in experimental design principles, "the experimental unit is randomly assigned to treatment" . This randomization is essential for valid statistical analysis.

Treatment Variables:
For functional characterization, treatments would typically include:

  • Different bitter compounds as potential agonists

  • Varying concentrations of each compound

  • Positive and negative controls

  • Potential antagonists or modulators

Replication Strategy:
Ensure proper replication of experiments as "the repetition of the experimental situation by replicating the experimental unit" . Consider using a Completely Randomized Design (CRD) if your experimental material (cells expressing recombinant Tas2r124) is relatively homogeneous .

Factor Analysis:
Treat variables like compound type, concentration, and cellular context as experimental factors. Determine whether these are fixed factors (all levels of interest included) or random factors (levels randomly chosen from all possible levels) .

What are the optimal heterologous expression systems for studying recombinant rat Tas2r124?

Based on methodologies used for mouse Tas2r receptors, the following expression systems are recommended:

HEK293T Cell System:
HEK293T cells stably expressing either Gα15 or Gα16gust44 have proven effective for mouse Tas2r functional studies . The Gα16gust44-based system appears to offer higher sensitivity, especially for detecting responses to low-efficacy activators . Specifically, experiments with mouse Tas2r105 demonstrated that "the Gα16gust44 cell system shows higher sensitivity than the Gα15-based assay" .

Expression Verification Protocol:

  • Transfect cells with N-terminal epitope-tagged (e.g., Rho-tag) recombinant rat Tas2r124

  • Perform immunocytochemistry on both permeabilized and non-permeabilized cells to assess surface expression

  • Include appropriate controls (mock-transfected cells)

  • Document expression patterns in a format similar to the table presented for mouse Tas2r receptors :

ReceptorBefore permeabilizationAfter permeabilization
Tas2r124+/-+
Mock--

What methods are most effective for measuring Tas2r124 activation?

The following methods are recommended for measuring activation of recombinant rat Tas2r124:

Calcium Imaging:
Monitor intracellular calcium changes in response to potential agonists using calcium-sensitive fluorescent dyes. This approach has been successfully employed for mouse Tas2r characterization .

Dose-Response Analysis:
Generate full dose-response curves for active compounds to determine:

  • EC50 values (half-maximal effective concentration)

  • Hill coefficients

  • Maximum response amplitudes

Signaling Pathway Verification:
Confirm signaling through expected G protein-coupled pathways using:

  • Phospholipase C inhibitors

  • IP3 receptor blockers

  • Calcium chelators

Data from these experiments should be presented in dose-response curves and organized in tables showing activation thresholds and potency rankings of various agonists.

How does the agonist profile of rat Tas2r124 compare with other Tas2r family members?

The agonist profile of rat Tas2r124 is likely to exhibit specific patterns of selectivity or promiscuity. Based on mouse Tas2r studies, bitter taste receptors vary considerably in their tuning breadth, from narrowly tuned "specialist" receptors to broadly tuned "generalist" receptors that can recognize >30% of tested bitter compounds .

To characterize the agonist profile:

  • Screen a diverse bitter compound library against cells expressing recombinant rat Tas2r124

  • Compare activation patterns with other Tas2r family members

  • Classify the receptor as either a specialist or generalist based on its response profile

  • Determine if there are species-specific differences compared to mouse or human orthologs

Mouse studies have shown that "most bitter compounds activated several mouse Tas2r" with some compounds activating up to seven different receptors . This suggests potential redundancy in the bitter taste system that should be investigated for rat Tas2r124 as well.

What factors affect the cell surface expression and functionality of recombinant rat Tas2r124?

Several factors may influence the cell surface expression and functionality of recombinant rat Tas2r124:

N-terminal Modifications:
The addition of epitope tags to the N-terminus may affect trafficking and function. Studies with mouse Tas2r receptors showed variable cell surface expression patterns when modified with Rho epitope tags .

Cellular Context:
The host cell type and the presence of specific G protein subunits significantly impact functional responses. Mouse studies demonstrated that "low efficacy activators of Tas2r105 result in lower or even absent responses in Gα15-expressing cells" compared to Gα16gust44-expressing cells .

Co-expressed Proteins:
Auxiliary proteins that might facilitate proper folding, trafficking, or signaling should be considered. Researchers should systematically investigate these factors through:

  • Comparison of different tagging strategies

  • Testing in multiple cell lines

  • Co-expression with various G protein subunits

  • Assessment of receptor internalization dynamics

How can contradictory findings in Tas2r124 research be reconciled?

When faced with contradictory findings in Tas2r124 research, consider the following methodological differences that might explain discrepancies:

Experimental System Sensitivity:
Different experimental systems may yield contradictory results due to varying sensitivity. In mouse studies, researchers found that "the Gα16gust44 cell system shows higher sensitivity than the Gα15-based assay" , explaining why some agonists were detected in one system but not another.

Data Analysis Approach:
Use structured experimental design analysis to reconcile contradictory findings:

  • Identify the specific experimental unit used in each study

  • Evaluate the treatment application methodologies

  • Compare replication strategies and statistical approaches

  • Consider whether the experiment used a Completely Randomized Design (CRD) or another design

Systematic Meta-analysis:
Conduct a meta-analysis of contradictory findings by:

  • Standardizing data from different studies

  • Comparing statistical power across studies

  • Evaluating methodological differences systematically

  • Testing critical variables in a controlled experimental setting

What methods are most reliable for quantifying Tas2r124 expression across different tissues?

For reliable quantification of Tas2r124 expression:

Quantitative RT-PCR (qRT-PCR):
This method has successfully detected expression differences of Tas2r genes in mouse studies . Design rat-specific primers for Tas2r124 and normalize expression to appropriate housekeeping genes. Consider using α-gustducin as a reference in gustatory tissues as done in mouse studies .

In Situ Hybridization:
This technique provides cellular resolution of expression patterns. The approach should include:

  • Design of specific RNA probes for rat Tas2r124

  • Use of both sense and antisense probes as controls

  • Comparison with known markers such as α-gustducin

  • Quantification of staining intensity and cell numbers expressing Tas2r124

Data Presentation:
Results should be presented as relative expression levels across tissues, similar to mouse studies that showed "Tas2r124, which showed low to moderate expression levels in gustatory tissue" but high expression in testis.

How does Tas2r124 expression in gustatory versus non-gustatory tissues inform its function?

The differential expression of Tas2r124 between gustatory and non-gustatory tissues provides important functional insights:

Gustatory Function:
In gustatory tissues, Tas2r124 likely contributes to bitter taste perception as part of the bitter receptor family. Its relatively moderate expression in mouse gustatory tissues suggests it may respond to specific bitter compounds rather than serving as a broadly tuned receptor.

Extra-oral Functions:
The high expression of Tas2r124 in mouse testis points to potential roles beyond taste perception. These might include:

  • Chemosensing in reproductive tissues

  • Regulation of cellular processes in response to bitter compounds

  • Involvement in signaling pathways independent of conscious taste perception

Research questions should address whether these expression patterns are conserved in rats and how they relate to specific physiological functions in each tissue.

How has Tas2r124 evolved across different species and what are the functional implications?

Research into Tas2r124 evolution should address:

Sequence Conservation:
Compare rat Tas2r124 with orthologs from other species, particularly mouse where studies have shown expression in both gustatory and non-gustatory tissues . Analyze conservation of:

  • Transmembrane domains

  • Ligand-binding regions

  • G-protein interaction sites

Functional Divergence:
Investigate whether different species' orthologs respond to the same agonists or have developed species-specific responses. Mouse studies have shown that even closely related Tas2r receptors can have significantly different agonist profiles .

Adaptive Evolution:
Examine whether sequence variations in Tas2r124 across species correlate with dietary adaptations or environmental exposures to bitter compounds.

This evolutionary analysis provides context for understanding species-specific functions and may help predict the agonist profile of rat Tas2r124 based on its evolutionary relationship to better-characterized receptors from other species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.