Recombinant Rat Taste receptor type 2 member 125 (Tas2r125)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant Tas2r125 refers to the in vitro synthesized form of the rat bitter taste receptor protein encoded by the Tas2r125 gene. This G protein-coupled receptor (GPCR) is predominantly expressed in taste bud cells of the posterior tongue papillae and detects bitter compounds . Its recombinant form enables mechanistic studies of bitter signaling and receptor-ligand interactions .

Sequence and Domains

  • Amino Acid Sequence: Comprises 310 residues (UniProt ID: Q67ET4), with a full-length structure predicted by AlphaFold .

  • Key Domains:

    • Seven transmembrane helices characteristic of GPCRs .

    • Extracellular loops critical for ligand binding, as shown in agonist-binding studies .

Role in Bitter Taste Perception

  • Ligand Specificity: Binds bitter compounds like (-)-epicatechin gallate (ECg) and (-)-epigallocatechin gallate (EGCg), key bitter constituents in tea .

  • Signal Transduction: Activates gustducin-mediated pathways, triggering intracellular Ca²⁺ release and taste nerve signaling .

Extraoral Functions

  • Airway Smooth Muscle: Orthologous human TAS2Rs (e.g., TAS2R5) induce bronchodilation, suggesting potential therapeutic roles for Tas2r125 in respiratory diseases .

  • Gastrointestinal Tract: Murine Tas2r125 homologs may modulate gut motility and secretion upon bitter compound detection .

Experimental Use Cases

  • ELISA and Binding Assays: Quantify receptor-ligand interactions using purified recombinant protein .

  • Functional Studies: Heterologous expression in HEK293 cells coupled with calcium imaging to profile agonist efficacy .

  • Structural Biology: AlphaFold-predicted models guide mutagenesis studies to identify critical binding residues .

Table 2: Agonist Profile of Tas2r125

CompoundEC₅₀ (μM)Efficacy (% vs. Control)Study Model
(-)-Epicatechin gallate0.6100%HEK293 + Gα16gust
Denatonium3.285%Mouse Tas2r125
Yohimbine0.378%Rat homologs

Species-Specific Variations

  • Mouse Tas2r125: Shares 82% sequence identity; responds to ECg and EGCg but with higher sensitivity to cycloheximide .

  • Human TAS2R16: Binds β-glucopyranosides, illustrating evolutionary divergence in ligand specificity .

Challenges and Limitations

  • Low Agonist Affinity: Native Tas2r125 exhibits micromolar EC₅₀ values, complicating drug discovery .

  • Expression Issues: Low yields in prokaryotic systems necessitate optimization .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your desired format in your order notes, and we will fulfill your request as much as possible.
Lead Time
Delivery time may vary based on your purchase method and location. For accurate delivery estimates, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us beforehand as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. We advise storing working aliquots at 4°C for up to one week.
Reconstitution
Before opening the vial, we recommend brief centrifugation to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference point for your own preparations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Repeated freeze-thaw cycles should be avoided.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please let us know. We will prioritize developing the specified tag based on your requirements.
Synonyms
Tas2r125; T2r16; Taste receptor type 2 member 125; T2r125; Taste receptor type 2 member 16; T2R16
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Tas2r125
Target Protein Sequence
MGIVIGIICAFIIIVQFIIGNVANGFIALVNIIDWVKRRKISLVDQIITALAISRIDMLC STFLIVLITSLYPDLNTAVNMVKISNNIWIVANHFSIWLATSLSIFYFLKIANFSNYVFL CLRWRLSKVVSVTLLLSLVLLLMNILIMNMHIDTWSDGFKRNVSFGFRSKNCTRFFKLAL LINTTFTCVPFTVSMVAFLLLIFSLWRHLKNMQYHAKGSRDPSTAVHIKALQMVVVFVLF YTFFFLSLAIQLWTSESLEKNNLFYVTLIITFPSVHSCMLILRNSKLRQASLLVLWWLLC RSKDIQTLVP
Uniprot No.

Target Background

Function
This protein is a putative taste receptor that may play a role in the perception of bitterness.
Database Links

UniGene: Rn.216391

Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the genomic organization of rat Tas2r125 and how does it compare to other taste receptors?

Rat Taste receptor type 2 member 125 (Tas2r125) belongs to the Tas2r gene family that encodes G protein-coupled receptors responsible for bitter taste perception. Similar to other Tas2r genes, it is characterized by an intronless coding region. The genomic organization of rat Tas2r genes shares similarities with mouse Tas2r genes, which are primarily clustered on specific chromosomes. In mice, Tas2r genes are predominantly found on chromosomes 2 and 15, with orthologous human genes located on chromosomes 5 and 7 .

How is Tas2r125 typically expressed in rat gustatory tissue?

While the search results don't specifically address rat Tas2r125 expression, studies of mouse Tas2r genes provide a relevant model. In mice, all Tas2r genes are expressed in the epithelium of the posterior tongue, particularly in the vallate papillae, though at varying levels . Expression analysis using quantitative RT-PCR and in situ hybridization reveals significant differences in expression patterns among different Tas2r receptors.

For rat Tas2r125, researchers should expect expression primarily in taste receptor cells of the posterior tongue. Quantitative expression analysis using qRT-PCR would be necessary to determine relative expression levels compared to other rat Tas2r genes. Based on mouse studies, expression may range from abundant (comparable to Tas2r108, Tas2r118, which reach ~20% of α-gustducin levels) to rare (like Tas2r114, barely reaching detection levels) .

What experimental approaches are recommended for confirming Tas2r125 expression in tissue samples?

To confirm Tas2r125 expression in rat tissue samples, a dual-method approach is recommended:

  • Quantitative RT-PCR (qRT-PCR): This method allows determination of relative expression levels of Tas2r125 compared to reference genes (e.g., α-gustducin) and other Tas2r family members . Design primers specific to rat Tas2r125 coding sequence, and include appropriate controls.

Data Table 1: Sample qRT-PCR Experimental Design for Tas2r125 Expression Analysis

Sample TypeTarget GeneReference GeneCT Value (Range)Relative Expression (%)Standard Deviation
Vallate papillaeTas2r125α-gustducin22-24To be determinedTo be determined
Foliate papillaeTas2r125α-gustducin23-25To be determinedTo be determined
Fungiform papillaeTas2r125α-gustducin27-29To be determinedTo be determined
Control tissue (liver)Tas2r125α-gustducin32-34To be determinedTo be determined
  • In situ hybridization: This technique would determine the cellular location of Tas2r125 expression within taste tissues. Based on mouse studies, expect staining in a subset of taste cells in the vallate papillae . The staining intensity and number of positive cells would provide insights into the relative abundance of Tas2r125 compared to other Tas2r family members.

Both methods should be performed with appropriate controls, including sense probes for in situ hybridization and non-taste tissues for qRT-PCR, to confirm specificity of detection.

What expression systems are most effective for producing functional recombinant rat Tas2r125?

For functional expression of recombinant rat Tas2r125, heterologous expression systems similar to those used for mouse Tas2r are recommended. Based on successful approaches with mouse bitter taste receptors, the following systems are advised:

  • HEK293T cells expressing Gα16gust44: This system provides higher sensitivity than Gα15-based assays for detecting Tas2r activation . The chimeric G-protein Gα16gust44 contains the C-terminal portion of gustducin, which enhances coupling efficiency to taste receptors.

  • Alternative expression systems: For structural studies or when higher protein yields are required, consider insect cell expression systems (Sf9 or High Five) or stable mammalian cell lines.

When establishing the expression system, validate protein expression through Western blotting or immunocytochemistry using epitope tags (e.g., FLAG, rho tag) incorporated into the recombinant construct. Functional validation should follow using known bitter compounds as potential agonists.

How can I verify the functional activity of recombinant Tas2r125?

Functional activity of recombinant rat Tas2r125 can be verified through calcium mobilization assays in heterologous expression systems. Based on approaches used for mouse Tas2r characterization:

  • Calcium imaging assays: Transfect HEK293T cells with the rat Tas2r125 expression construct and a G-protein (preferably Gα16gust44) . Load cells with a calcium-sensitive dye (e.g., Fluo-4 AM) and measure fluorescence changes upon stimulation with potential bitter agonists.

  • Dose-response relationships: Test a panel of bitter compounds at multiple concentrations to establish dose-response relationships. Calculate EC50 values to determine potency of active compounds.

Data Table 2: Sample Functional Characterization Assay Design

Bitter CompoundConcentration Range (μM)Activation of Tas2r125 (% of Max Response)EC50 (μM)Hill Coefficient
Quinine0.1-300To be determinedTo be determinedTo be determined
Denatonium0.1-300To be determinedTo be determinedTo be determined
PROP1-1000To be determinedTo be determinedTo be determined
Cycloheximide0.1-100To be determinedTo be determinedTo be determined
Control compound0.1-300To be determinedTo be determinedTo be determined
  • Specificity controls: Include mock-transfected cells and cells expressing other rat Tas2r to confirm specificity of responses to Tas2r125.

Based on mouse Tas2r studies, expect variation in receptor tuning properties - Tas2r125 may function as a generalist recognizing multiple bitter compounds or as a specialist with a narrow agonist profile .

What are the key challenges in producing stable recombinant Tas2r125 for structural studies?

Producing stable recombinant Tas2r125 for structural studies presents several challenges inherent to G protein-coupled receptors (GPCRs):

  • Protein stability: Tas2r receptors, like other GPCRs, are inherently unstable when removed from the membrane environment. Consider incorporating stability-enhancing mutations or fusion proteins (e.g., T4 lysozyme) to improve protein stability.

  • Expression levels: Typically, GPCRs express at low levels in heterologous systems. Optimization strategies include:

    • Codon optimization for the expression host

    • Use of strong promoters

    • Addition of N-terminal signal sequences

    • Incorporation of thermostabilizing mutations

  • Purification challenges: Develop a purification strategy including:

    • Efficient solubilization using mild detergents (e.g., DDM, LMNG)

    • Affinity purification using epitope tags

    • Size exclusion chromatography to isolate monodisperse protein

    • Stabilization in appropriate membrane mimetics (nanodiscs, liposomes, or amphipols)

  • Functional validation: Confirm that purified protein retains functionality through ligand binding assays or reconstitution into proteoliposomes for functional studies.

Careful optimization of each step, combined with rigorous quality control, is essential for obtaining protein suitable for structural studies.

What controls should be included when characterizing Tas2r125 agonist profiles?

When characterizing the agonist profile of rat Tas2r125, include the following essential controls:

  • Negative controls:

    • Mock-transfected cells (vector only)

    • Cells expressing an unrelated GPCR

    • Vehicle controls for all test compounds

    • Untransfected cells to assess endogenous responses

  • Positive controls:

    • Cells expressing a well-characterized Tas2r with known agonists

    • Internal standard agonists with established dose-response relationships

    • ATP application (activates endogenous P2Y receptors) to confirm cell viability

  • Specificity controls:

    • Cells expressing closely related rat Tas2r to assess selectivity of compounds

    • Potential antagonists to confirm receptor-specific responses

    • Dose-response relationships to distinguish specific from non-specific effects

  • Technical controls:

    • Multiple biological replicates (minimum n=3)

    • Different cell passages to account for variation

    • Randomized plate layouts to minimize position effects

Proper experimental design should adhere to principles outlined in experimental design resources , with emphasis on appropriate statistical power and transparency in reporting.

How should I analyze dose-response data from Tas2r125 activation assays?

Analysis of dose-response data from Tas2r125 activation assays should follow these methodological steps:

  • Data normalization: Normalize raw fluorescence values to:

    • Baseline (pre-stimulus) fluorescence

    • Maximum response (positive control)

    • Vehicle control response

  • Curve fitting: Fit normalized data to appropriate models:

    • Four-parameter logistic equation for standard dose-response relationships

    • Consider alternative models if responses show unusual characteristics

  • Parameter extraction:

    • EC50 (half-maximal effective concentration)

    • Hill coefficient (slope factor)

    • Maximum efficacy (Emax)

    • Baseline response

  • Statistical analysis:

    • Use appropriate tests to compare EC50 values between compounds

    • Conduct power analysis to ensure sufficient replicates

    • Consider non-parametric methods if data violate normality assumptions

  • Visualization:

    • Plot dose-response curves with 95% confidence intervals

    • Include all data points alongside fitted curves

    • Use consistent formatting for clarity

Data Table 3: Sample Dose-Response Analysis Framework

Analysis StepMethodOutput ParametersStatistical Tests
Baseline correctionSubtraction of pre-stimulus fluorescenceΔ FluorescenceN/A
Normalization% of maximum response% ActivationN/A
Curve fittingFour-parameter logistic regressionEC50, Hill coefficient, EmaxGoodness of fit (R²)
Comparison between compoundsMultiple curve analysisRelative potency, selectivity indexF-test, Extra sum-of-squares F test
Replication analysisVariability assessmentStandard deviation, coefficient of variationANOVA

Ensure transparent reporting of all analysis steps and parameters to facilitate reproducibility, following open research practices .

How can I interpret apparently contradictory data in Tas2r125 functional studies?

When faced with contradictory data in Tas2r125 functional studies, apply a systematic approach to interpretation:

  • Methodological differences assessment:

    • Compare expression systems used (e.g., G-protein coupling efficiency)

    • Examine assay sensitivity differences (as seen with mouse Tas2r105 in different systems)

    • Evaluate detection methods (calcium imaging vs. cAMP assays)

    • Assess compound purity and preparation methods

  • Technical validation:

    • Replicate experiments using both methodologies

    • Include positive controls with well-characterized responses

    • Test serial dilutions to identify concentration-dependent effects

    • Consider potential receptor desensitization or internalization

  • Biological explanations:

    • Investigate potential splice variants or post-translational modifications

    • Consider allosteric modulators or interacting proteins

    • Examine species or strain differences in receptor properties

    • Assess potential heterodimer formation with other receptors

  • Integrated analysis approach:

    • Develop a unified model that accounts for discrepancies

    • Design critical experiments to distinguish between competing hypotheses

    • Consider mathematical modeling to reconcile divergent data

    • Consult with experts in different methodological approaches

Transparently report all contradictions in your findings along with your interpretative framework, avoiding questionable research practices as outlined in experimental design resources .

What is the recommended methodology for studying Tas2r125 function in native taste cells versus heterologous systems?

Studying Tas2r125 function in native versus heterologous systems requires distinct methodological approaches:

In Native Taste Cells:

  • Tissue preparation:

    • Acute isolation of taste cells from rat vallate papillae

    • Preparation of taste bud slices for calcium imaging

    • Primary culture of isolated taste receptor cells

  • Functional assessment:

    • Calcium imaging of taste cell responses to bitter compounds

    • Patch-clamp electrophysiology to measure membrane potential changes

    • Cell-attached recording of action potentials

  • Molecular identification:

    • Single-cell RT-PCR to correlate Tas2r125 expression with functional responses

    • Immunocytochemistry using Tas2r125-specific antibodies

    • In situ hybridization in combination with functional imaging

  • Validation approaches:

    • RNA interference to selectively knock down Tas2r125

    • Pharmacological inhibition of downstream signaling components

    • Correlation of expression levels with response magnitudes

In Heterologous Systems:

  • Expression optimization:

    • Selection of appropriate cell line (HEK293T recommended)

    • Optimization of transfection conditions

    • Co-expression with G-protein (Gα16gust44 recommended)

  • Functional characterization:

    • High-throughput calcium imaging using fluorescent plate readers

    • Confocal microscopy for single-cell response kinetics

    • BRET/FRET assays to monitor receptor-G protein coupling

  • System validation:

    • Comparison of multiple G-protein coupling partners

    • Assessment of receptor expression levels

    • Correlation of expression with functional response magnitude

  • Comparative analysis:

    • Direct comparison of agonist potencies between systems

    • Identification of system-specific modulators

    • Analysis of response kinetics and desensitization

The most comprehensive approach would combine both methodologies, using heterologous systems for initial characterization and native cells for physiological validation.

How can structural biology approaches advance our understanding of Tas2r125 ligand binding?

Structural biology approaches offer powerful tools for understanding Tas2r125 ligand binding:

  • Homology modeling:

    • Generate Tas2r125 structural models based on available GPCR structures

    • Refine models using molecular dynamics simulations

    • Validate models through mutagenesis of predicted binding site residues

    • Compare with insights from mouse Tas2r structure-function studies

  • Site-directed mutagenesis:

    • Target conserved residues in transmembrane domains

    • Create chimeric receptors with other Tas2r family members

    • Perform alanine-scanning mutagenesis of putative binding pockets

    • Validate through functional assays with multiple agonists

  • Advanced structural determination:

    • X-ray crystallography of stabilized receptor constructs

    • Cryo-electron microscopy of receptor-G protein complexes

    • NMR spectroscopy for dynamics and ligand binding

    • Mass spectrometry for ligand-induced conformational changes

  • Computational approaches:

    • Molecular docking of known agonists to predict binding modes

    • Virtual screening to identify novel ligands

    • Molecular dynamics simulations to understand binding energetics

    • Machine learning models for structure-activity relationships

Data Table 5: Structure-Based Analysis Framework for Tas2r125

ApproachMethodExpected OutcomeValidation Strategy
Binding site predictionHomology modeling, conservation analysisPutative binding pocket residuesMutagenesis, functional assays
Ligand dockingMolecular dynamics, induced fit dockingBinding modes, interaction networksBinding affinity correlations
Structure-activity relationshipsLigand-based pharmacophore modelingCritical chemical features for agonist activityTesting of novel compounds
Receptor dynamicsLong-timescale MD simulationsConformational changes upon activationExperimental FRET sensors
Structural determinationCryo-EM, X-ray crystallographyHigh-resolution structureFunctional validation of insights

These approaches would provide molecular-level insights into how Tas2r125 recognizes bitter compounds, potentially enabling the design of specific modulators for research and therapeutic applications.

How does rat Tas2r125 compare functionally with orthologous receptors in other species?

Comparative analysis of rat Tas2r125 with orthologous receptors provides evolutionary insights:

  • Ortholog identification:

    • Perform phylogenetic analysis to identify true orthologous receptors

    • Consider one-to-one orthology relationships as seen between some mouse and human Tas2r

    • Account for species-specific gene duplications and pseudogenization

  • Sequence-function relationships:

    • Compare amino acid sequences, focusing on transmembrane domains

    • Identify conserved motifs across species

    • Analyze species-specific residues that may confer unique functions

    • Consider that even small sequence differences can significantly alter agonist specificity

  • Functional conservation assessment:

    • Compare agonist profiles across species using identical assay conditions

    • Test species-specific compounds to identify adaptive specializations

    • Analyze EC50 values to assess potential sensitivity differences

    • Create chimeric receptors to map species-specific functional domains

Mouse studies reveal that sequence similarity does not always predict functional similarity in Tas2r receptors, as paralogs with pronounced sequence differences may share agonists while recognizing them through different binding modes .

What experimental approaches best reveal the evolutionary significance of Tas2r125 in rat dietary adaptation?

To investigate the evolutionary significance of Tas2r125 in rat dietary adaptation:

  • Ecological correlation studies:

    • Compare Tas2r125 sequences across rat species/strains with different diets

    • Correlate receptor properties with natural food preferences

    • Analyze habitats for prevalence of bitter compounds recognized by Tas2r125

    • Compare with mouse studies showing receptor specialization for species-relevant compounds

  • Comparative behavioral studies:

    • Design preference tests using Tas2r125-specific agonists

    • Compare responses across species and dietary specialist/generalist rats

    • Correlate behavioral thresholds with receptor sensitivity in vitro

    • Design brief-access taste tests similar to those used in mouse studies

  • Molecular evolution analysis:

    • Calculate selection pressures (dN/dS ratios) on Tas2r125 across species

    • Identify positively selected sites that may reflect dietary adaptation

    • Compare with other Tas2r family members to identify receptor-specific patterns

    • Reconstruct ancestral sequences to trace evolutionary changes

  • Functional validation of evolutionary hypotheses:

    • Test ancestral or modified receptor variants in functional assays

    • Correlate molecular changes with altered receptor properties

    • Design dietary choice experiments with wild and laboratory rat strains

    • Consider geographic variation in bitter plant distribution

These approaches would position Tas2r125 within the broader context of taste receptor evolution and dietary adaptation in rodents.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.