Recombinant Rat Taste receptor type 2 member 13 (Tas2r13)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rat Taste Receptor Type 2 Member 13 (Tas2r13)

Recombinant Rat Taste receptor type 2 member 13 (Tas2r13) is a protein produced through recombinant DNA technology, specifically designed for research purposes. This receptor is part of the bitter taste receptor family, which plays a crucial role in detecting bitter compounds in food and beverages. Tas2r13 is expressed in the rat genome and is used in scientific studies to understand bitter taste perception and its implications in various physiological processes.

Production and Source

The recombinant rat Tas2r13 is typically produced using an in vitro E. coli expression system. This method involves inserting the gene encoding Tas2r13 into E. coli bacteria, which then express the protein. The recombinant protein is purified and made available for research applications, such as studying bitter taste mechanisms and potential interactions with various compounds.

Product DetailsDescription
CodeCSB-CF862400RA
SourceIn vitro E. coli expression system
KEGGrno:78983
STRING10116.ENSRNOP00000007521
UniGeneRn.48786

Research Findings and Applications

Research on Tas2r13 and other bitter taste receptors has shown that genetic variations can influence alcohol consumption and bitter taste perception. For instance, studies on human TAS2R13 have found associations between genetic variations and alcohol intake patterns . While specific studies on recombinant rat Tas2r13 might be limited, its use in research can help elucidate the mechanisms of bitter taste perception and its role in dietary preferences and health outcomes.

Docking Analysis and Inhibition Mechanisms

Docking analysis of phenolic compounds with TAS2R receptors, including TAS2R13, has revealed diverse inhibition mechanisms. These compounds interact with the receptor using hydrophobic pockets, similar to those used by denatonium, a known bitter compound . Understanding these interactions can provide insights into how different substances affect bitter taste perception.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please specify this in your order; we will prioritize its development.
Synonyms
Tas2r13; Tas2r7; Taste receptor type 2 member 13; T2R13; Taste receptor type 2 member 7; T2R7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-305
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MGSSLYDILTIVMIAEFIFGNVTNGFIVLTNCIAWLSKRTLSFIGWIQLFLAISRVVLIW EMLLAWLKYMKYSFSYLAGTELRVMMLTWVVSNHFSLWLATILSIFYLLKIASFSRPVFL YLKWRVKKVLLLILLGNLIFLMFNILQINTHIEDWMDQYKRNITWDSRVNEFVGFSNLVL LEMIMFSVTPFTVALVSFILLIFSLWKHLQKMHLSSRGERDPSTKAHVNALRIMVSFLLL YATYFISFFISLIPMAHKKGLDLMFSLTVGLFYPSSHSFILILGHSNLRHSSCLVITYLR CKEKD
Uniprot No.

Target Background

Function

Recombinant Rat Taste receptor type 2 member 13 (Tas2r13) is a receptor potentially involved in bitterness perception and is gustducin-linked. It may contribute to sensing the gastrointestinal tract's chemical composition. Receptor activation may stimulate alpha-gustducin, mediate PLC-beta-2 activation, and subsequently gate TRPM5.

Database Links
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in subsets of taste receptor cells of the tongue and palate epithelium and exclusively in gustducin-positive cells. Expressed in 15% taste bud cells in circumvallate and foliate papillae but only in 2% in fungiform papillae. Expressed in the duo

Q&A

What is the expression pattern of Tas2r13 in rat gustatory tissues?

Tas2r13 is expressed in the posterior papillae of the tongue, similar to the expression pattern observed for other Tas2r family members in mice. Based on studies of mouse taste receptors, we can infer that rat Tas2r13 is likely expressed in a subset of taste receptor cells in the vallate papillae . The expression level may vary compared to other Tas2r genes, as observed in mice where some receptors show high abundance (reaching ~20% of α-gustducin mRNA levels) while others show much lower expression .

To determine the precise expression pattern, researchers should employ:

  • Quantitative RT-PCR to measure relative expression levels

  • In situ hybridization to visualize cellular localization

  • Single-cell RNA sequencing to identify co-expression patterns with other taste-related genes

Is Tas2r13 expressed in non-gustatory tissues of rats?

Based on studies of related bitter taste receptors, Tas2r13 likely has expression beyond gustatory tissues. Mouse studies have demonstrated that bitter taste receptor clusters are expressed in various organs including the heart, vascular smooth cells, and adipose tissue . For rat Tas2r13, researchers should investigate expression in:

  • Cardiovascular tissues (heart, vascular smooth muscle cells)

  • Gastrointestinal tract (particularly intestinal epithelium)

  • Respiratory system

  • Testis

Methodologically, a BAC-based transgenic approach using the Tas2r13 promoter driving a reporter gene (such as CreERT2 or EGFP) would enable comprehensive tissue mapping . Alternatively, tissue-specific RT-PCR with primers designed for rat Tas2r13 can provide initial expression data.

How can I validate the functionality of recombinant Rat Tas2r13?

To validate functionality of recombinant Rat Tas2r13:

  • Heterologous expression system: Express the receptor in HEK293T cells with either Gα15 or Gα16gust44, with the latter providing higher sensitivity for detecting receptor activation .

  • Calcium imaging assay: Use calcium-sensitive dyes to monitor intracellular calcium release upon receptor activation.

  • Compound screening: Test against a library of bitter compounds to determine the activation profile.

  • Control experiments: Include known bitter taste receptor agonists and antagonists as positive and negative controls.

  • Dose-response analysis: Determine EC50 values for identified agonists.

Note that sensitivity may vary depending on the G-protein coupled to the receptor, as demonstrated for mouse Tas2r105 where responses were stronger with Gα16gust44 compared to Gα15 .

How do genetic variations in Rat Tas2r13 affect ligand binding and receptor function?

Genetic variations in taste receptors can significantly impact receptor function and ligand specificity. For human TAS2R13, variations are associated with differences in alcohol consumption, suggesting functional consequences of these polymorphisms .

Methodological approach:

  • Sequence multiple rat strains to identify naturally occurring variations in Tas2r13.

  • Site-directed mutagenesis to introduce specific amino acid changes in the recombinant receptor.

  • Functional comparison using calcium imaging assays to determine how variants affect:

    • Agonist binding affinity

    • Signal transduction efficiency

    • Receptor desensitization

  • Homology modeling based on known GPCR structures to predict how amino acid substitutions affect the binding pocket.

  • In vivo behavioral testing with rats carrying different Tas2r13 variants to determine phenotypic consequences.

Key positions to investigate would include those in the N-terminal domain and transmembrane regions, as these areas are critical for ligand recognition in taste receptors .

What is the optimal expression system for producing functional recombinant Rat Tas2r13?

The expression of functional G protein-coupled receptors (GPCRs) like Tas2r13 presents significant challenges. Based on studies with related receptors, we recommend:

Expression SystemAdvantagesDisadvantagesOptimization Strategies
HEK293T cellsWell-established for taste receptors, endogenous G-proteinsMay lack specific cofactorsCo-expression with Gα16gust44 to enhance signaling
Sf9 insect cellsHigh expression levels, proper foldingMore complex culture conditionsUse of baculovirus expression vector
Yeast systemsCost-effective, scalableMay have different post-translational modificationsCodon optimization for yeast expression
Cell-free systemsRapid production, membrane protein-friendlyLower yieldsAddition of lipid nanodiscs

For functional studies, HEK293T cells co-expressing Gα16gust44 are recommended as they provide higher sensitivity than systems using Gα15 . For structural studies requiring larger protein quantities, insect cell systems may be preferable.

How does the ligand specificity of Rat Tas2r13 compare to its mouse and human orthologs?

Taste receptors show species-specific differences in ligand recognition despite sequence homology. To characterize Rat Tas2r13 specificity compared to orthologs:

  • Comparative functional assays:

    • Express rat, mouse, and human orthologs in the same cell system

    • Test against an identical panel of bitter compounds

    • Use the same signal detection method (calcium imaging)

  • Chimeric receptor approach:

    • Generate chimeric receptors with domains from different species

    • Identify regions responsible for species-specific responses

  • Data analysis:

    • Compare EC50 values for shared ligands

    • Identify compounds that activate only species-specific orthologs

    • Calculate selectivity indices

Mouse studies show that bitter taste receptors vary widely in their tuning breadth, from very selective to broadly tuned receptors recognizing many compounds . Determining where Rat Tas2r13 falls on this spectrum is essential for understanding its physiological role.

What are the molecular mechanisms of Tas2r13 signal transduction in non-gustatory tissues?

Bitter taste receptors in non-gustatory tissues may utilize different signaling pathways than in taste cells. To investigate Rat Tas2r13 signaling:

  • Pathway analysis:

    • Examine coupling to different G-proteins (Gαgustducin, Gαi, Gαq/11)

    • Measure second messengers (calcium, cAMP, IP3)

    • Use specific pathway inhibitors to determine signaling dependencies

  • Tissue-specific differences:

    • Compare signaling in primary cells from different tissues expressing Tas2r13

    • Analyze co-expression with potential signaling partners

  • Physiological outcomes:

    • In vascular tissue: measure contractility

    • In immune cells: assess cytokine production

    • In gut cells: monitor hormone release

Bitter taste receptors in non-gustatory tissues may have evolved different sensitivities and coupling mechanisms to serve tissue-specific functions . Understanding these differences is crucial for interpreting physiological roles of Tas2r13 outside the oral cavity.

What are the best approaches for studying Tas2r13 expression in rat intestinal cells?

Tas2r bitter receptors are expressed along the gastrointestinal tract, suggesting roles beyond taste perception. For Rat Tas2r13 intestinal expression studies:

  • Tissue sampling strategy:

    • Collect samples from multiple regions (duodenum, jejunum, ileum, colon)

    • Separate epithelial cells from underlying tissues

    • Consider crypt-villus axis for regional differences

  • Detection methods:

    • RT-qPCR with region-specific primers

    • RNAscope in situ hybridization for cellular resolution

    • Cell type-specific markers to identify expressing cell populations

  • Functional validation:

    • Organoid cultures from intestinal epithelium

    • Calcium imaging with bitter compounds

    • Measurements of physiological responses (mucus secretion, hormone release)

Studies in mice revealed that some Tas2r genes (like Tas2r131) are expressed in specific intestinal cell types such as goblet cells . Determining if Rat Tas2r13 shows similar patterns will provide insights into its functional role in intestinal chemosensation.

What controls should be included when validating antibodies against Rat Tas2r13?

Antibody validation is critical for reliable detection of Tas2r13. A comprehensive validation protocol should include:

  • Positive controls:

    • Recombinant Rat Tas2r13 expressed in HEK293T cells

    • Rat taste tissue (vallate papillae) known to express Tas2r family receptors

  • Negative controls:

    • Tissues from Tas2r13 knockout rats (if available)

    • Pre-adsorption of antibody with immunizing peptide

    • Secondary antibody only controls

  • Specificity tests:

    • Western blot showing band at predicted molecular weight

    • Immunoprecipitation followed by mass spectrometry

    • Cross-reactivity testing with closely related Tas2r family members

  • Method-specific validations:

    • For IHC/ICC: Compare multiple fixation protocols

    • For flow cytometry: Compare with mRNA expression

    • For ELISA: Establish standard curves with recombinant protein

Given the high sequence similarity among Tas2r family members, special attention must be paid to antibody specificity to avoid cross-reactivity with other bitter taste receptors.

How should discrepancies between in vitro and in vivo Tas2r13 studies be interpreted?

Researchers often encounter contradictions between heterologous expression studies and in vivo observations. When analyzing such discrepancies:

  • Consider system differences:

    • Expression levels in heterologous systems typically exceed physiological levels

    • Absence of native regulatory proteins in cell lines

    • G-protein coupling differences (e.g., Gα16gust44 vs. native G-proteins)

  • Reconciliation approaches:

    • Use multiple heterologous systems with different G-proteins

    • Compare primary cells to recombinant systems

    • Develop conditional knockout models for in vivo validation

  • Data integration framework:

    • Establish physiologically relevant concentration ranges

    • Consider receptor sensitivity in different contexts

    • Account for potential receptor heteromerization

Studies with mouse Tas2r105 demonstrated that the choice of G-protein (Gα15 vs. Gα16gust44) significantly affected the detection of low-efficacy agonists, explaining apparent contradictions in previous reports . Similar considerations may apply to Rat Tas2r13 studies.

What statistical approaches are most appropriate for analyzing Tas2r13 ligand screening data?

When analyzing large-scale screening data for Rat Tas2r13:

  • Data normalization:

    • Normalize to positive control responses (e.g., ATP in calcium imaging)

    • Consider Z-score normalization for plate-to-plate comparisons

    • Account for baseline drift during long experiments

  • Statistical methods:

    • Use non-parametric tests if normality cannot be assumed

    • Apply false discovery rate corrections for multiple comparisons

    • Implement concentration-response modeling (Hill equation fitting)

  • Classification criteria:

    • Establish clear thresholds for agonist classification

    • Consider both efficacy (maximum response) and potency (EC50)

    • Validate hits with repeated independent experiments

  • Advanced analysis:

    • Structure-activity relationship analysis for related compounds

    • Principal component analysis to identify chemical features determining activity

    • Hierarchical clustering to group compounds by response patterns

Mouse Tas2r studies categorized receptors from specialists (responding to few compounds) to generalists (responding to >30% of compounds tested) . Similar categorization could be applied to Rat Tas2r13 following comprehensive ligand screening.

What are common pitfalls in Tas2r13 functional expression studies and how can they be addressed?

Researchers frequently encounter challenges when expressing functional taste receptors. For Rat Tas2r13:

  • Poor surface expression:

    • Problem: Receptor retained in endoplasmic reticulum

    • Solution: Add N-terminal tags known to enhance surface expression

    • Validation: Confirm membrane localization with surface biotinylation

  • Weak functional responses:

    • Problem: Insufficient signal-to-noise ratio in functional assays

    • Solution: Use Gα16gust44 instead of Gα15 for enhanced coupling

    • Validation: Test known bitter compounds at high concentrations

  • Non-specific responses:

    • Problem: Compounds activate cells independent of receptor

    • Solution: Include mock-transfected controls for all test compounds

    • Validation: Confirm response inhibition with receptor antagonists

  • Inconsistent results:

    • Problem: Variation between experiments

    • Solution: Standardize cell passage number, expression time, and assay conditions

    • Validation: Include internal standards in each experiment

  • Species mismatch issues:

    • Problem: Using signaling components from different species

    • Solution: Use species-matched G-proteins and signal transduction elements

    • Validation: Compare with native tissue responses when possible

How can the issue of receptor desensitization be addressed in long-term Tas2r13 studies?

Taste receptor desensitization can complicate experimental interpretation. Strategies to address this include:

  • Pulse stimulation protocols:

    • Brief agonist applications with washout periods

    • Monitor recovery time course after stimulation

    • Use automated perfusion systems for precise timing

  • Phosphorylation analysis:

    • Monitor receptor phosphorylation status after stimulation

    • Identify kinases involved in desensitization

    • Create phosphorylation-resistant mutants for mechanism studies

  • Internalization monitoring:

    • Quantify surface expression before and after stimulation

    • Track receptor trafficking using fluorescently tagged receptors

    • Measure recycling rates following internalization

  • Adaptation mechanisms:

    • Investigate downstream signaling component regulation

    • Study transcriptional feedback on receptor expression

    • Examine cross-desensitization with other taste receptors

Understanding desensitization mechanisms is particularly important when studying physiological roles of Tas2r13 in contexts involving prolonged or repeated exposure to bitter compounds.

What are emerging approaches for studying Tas2r13 physiological functions?

As research on bitter taste receptors expands beyond taste perception, several innovative approaches are emerging:

  • Organoid systems:

    • 3D cultures of taste papillae or intestinal epithelium

    • Maintenance of cellular diversity and organization

    • Allows for long-term functional studies

  • CRISPR-based approaches:

    • Generation of reporter knock-in rat lines

    • Tissue-specific conditional knockouts

    • Single nucleotide editing to study variant effects

  • Intravital imaging:

    • Real-time monitoring of receptor activation in live animals

    • Genetically encoded calcium or cAMP sensors

    • Correlation with physiological responses

  • Multi-omics integration:

    • Combining transcriptomics, proteomics, and metabolomics

    • Systems biology approaches to understand receptor networks

    • Pathway analysis in different tissues expressing Tas2r13

  • Single-cell approaches:

    • scRNA-seq to identify cell populations expressing Tas2r13

    • Spatial transcriptomics to map expression in tissue context

    • Cell-specific functional characterization

These emerging methods will help resolve outstanding questions about the physiological roles of Rat Tas2r13 in both gustatory and extra-gustatory tissues .

How might Tas2r13 research inform understanding of evolutionary adaptation in chemosensory systems?

Comparative studies of Tas2r13 across species can provide insights into evolutionary adaptation:

  • Phylogenetic analysis:

    • Compare sequences of Tas2r13 orthologs across mammalian species

    • Identify regions under positive or purifying selection

    • Correlate with dietary specialization and ecological niches

  • Functional divergence:

    • Compare ligand specificity between species

    • Identify species-specific agonists and antagonists

    • Determine if extra-oral functions are conserved across species

  • Receptor-ligand co-evolution:

    • Study how dietary bitter compounds shaped receptor evolution

    • Examine correlation between food preferences and receptor variants

    • Investigate potential pathogen-driven selection pressures

  • Genomic context analysis:

    • Compare gene clustering and regulatory elements across species

    • Examine duplication and pseudogenization patterns

    • Study epigenetic regulation in different tissues

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.