Recombinant Rat Taste receptor type 2 member 140 (Tas2r140)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant Rat Taste Receptor Type 2 Member 140 (Tas2r140) is a G protein-coupled receptor (GPCR) involved in bitter taste perception. It is produced through recombinant DNA technology, enabling its use in structural, functional, and pharmacological studies. Key features include:

PropertyDetails
UniProt IDQ67ES0
SpeciesRat (Rattus norvegicus)
Protein LengthFull-length (1–312 amino acids)
TagN-terminal His tag
Expression SystemsE. coli (for high yield) or mammalian cells (for post-translational modifications)
Purity>90% (SDS-PAGE verified)
Molecular Weight~36 kDa (calculated)
StorageLyophilized powder at -20°C/-80°C; reconstituted in Tris/PBS buffer

The amino acid sequence (MKVTVECALLITLIVEIIIGCLGNGFIAVVNIMDWTKRRRFSLVDQILTALAISR...) includes seven transmembrane domains characteristic of GPCRs .

Expression and Production Systems

Two primary production platforms are utilized:

  • Bacterial Expression (E. coli):

    • Yields non-glycosylated protein with high purity (>90%) .

    • Cost-effective for large-scale production but lacks eukaryotic post-translational modifications.

  • Mammalian Expression:

    • Produces glycosylated protein with endotoxin levels <1.0 EU/μg .

    • Preferred for functional assays requiring native-like folding .

Functional and Pharmacological Insights

Tas2r140 is a bitter taste receptor with roles beyond gustation, including immune modulation:

  • Bitter Compound Recognition:

    • Activated by quinine, denatonium, and yohimbine at micromolar concentrations .

    • Shares functional overlap with mouse Tas2r140, which responds to saccharin and cycloheximide .

  • Immune System Interactions:

    • While not directly studied in rat neutrophils, mouse orthologs (e.g., Tas2r126/143) enhance chemokine-driven migration via Rho-associated kinase (ROCK) pathways .

Research Applications

  • Ligand Screening: Used to identify bitter compounds in food additives and pharmaceuticals .

  • Structural Studies: His-tagged protein facilitates crystallization and cryo-EM analyses .

  • Immunoassays: Commercial ELISA kits (e.g., CBM15’s $1,664 product) quantify Tas2r140 in biological samples .

Emerging Research Directions

  • Signal Transduction Mechanisms: Studies on human TAS2R orthologs suggest Tas2r140 may employ multiple Gα subunits for downstream signaling .

  • Extraoral Functions: Potential roles in neutrophil migration or metabolic regulation, as observed in murine models .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
Tas2r140; Tas2r31; Taste receptor type 2 member 140; T2R140; Taste receptor type 2 member 31; T2R31
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-312
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Tas2r140
Target Protein Sequence
MKVTVECALLITLIVEIIIGCLGNGFIAVVNIMDWTKRRRFSLVDQILTALAISRLAFVW SLLTVLVISELHSSLLITRKMLRIINNFWTVTNHFSIWLATCLSIFYFLKIANFSNSIFL SLRWRVKTVVSLTLLVSLLLLLVNVIIINTCIVISVEGYKVNMSYSSHFNNNPQISRIPL FTNTMFTFIPFTVTLTIFLLLIFSLWRHLKKMQHRAKGPRDPSTTAHIKALQMVVTFLFL YTIFFLALVMQAWNNEIQSKTVFNLVFESIALAFPSGHSCVLILGNSKLRQAFLTIIWWL RSSFNAAELSSP
Uniprot No.

Target Background

Function
This protein is a putative taste receptor that may play a role in the perception of bitterness.
Database Links

KEGG: rno:689869

UniGene: Rn.216390

Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Tas2r140 and how does it function in taste perception?

Tas2r140 is a member of the Taste receptor type 2 (Tas2r) family, which are G protein-coupled receptors responsible for bitter taste perception in mammals. These receptors are primarily expressed in taste receptor cells located in taste buds on the tongue and palate. Based on mouse studies, Tas2r140 appears to be one of the less abundantly expressed bitter taste receptors, with mRNA levels "just reaching detection levels" compared to other family members . The receptor functions by binding specific bitter compounds, which triggers a signaling cascade involving G-proteins (typically gustducin) and calcium mobilization, ultimately leading to the perception of bitter taste.

How does the expression of Tas2r140 compare with other Tas2r family members?

Quantitative RT-PCR analysis of mouse taste receptors has shown that Tas2r expression levels vary significantly among family members. While some receptors like Tas2r108, Tas2r118, Tas2r126, Tas2r135, and Tas2r137 are quite abundant (reaching ~20% of the α-gustducin mRNA level), others including Tas2r114, Tas2r122, and Tas2r140 are expressed at very low levels, barely reaching detection thresholds . Additionally, in situ hybridization experiments have confirmed this variable expression pattern at the cellular level, with more abundantly expressed receptors like Tas2r118 showing strong signals in a large subset of vallate taste cells, while less expressed receptors show faint staining in fewer cells .

What are the recommended methods for detecting Tas2r140 expression in tissue samples?

For detecting Tas2r140 expression in rat tissue samples, two complementary approaches are recommended based on mouse studies:

  • Quantitative RT-PCR (qRT-PCR):

    • This method provides quantitative measurement of mRNA expression levels

    • Can be used to compare expression across different tissues

    • Requires careful primer design and optimization for specificity

    • Should include appropriate reference genes (e.g., α-gustducin) for normalization

  • In situ hybridization:

    • Allows visualization of Tas2r140 expression at the cellular level

    • Helps determine which specific cells within taste buds express the receptor

    • Can reveal heterogeneity in expression patterns among taste cells

    • May require highly sensitive detection methods due to the low expression level of Tas2r140

For both methods, appropriate controls are essential, including sense probes for in situ hybridization and no-template controls for qRT-PCR to confirm specificity of detection.

What experimental design is most appropriate for studying Tas2r140 function?

When designing experiments to study Tas2r140 function, several experimental design approaches can be considered:

  • Completely randomized design: In this approach, treatments (e.g., potential Tas2r140 agonists) are randomly assigned to experimental units (cells expressing the receptor). This design is suitable for initial screening studies where all conditions are relatively uniform .

  • Randomized block design: This design accounts for known sources of variation by grouping experimental units into blocks. For instance, experiments could be blocked by transfection batch, day of experiment, or cell passage number to minimize the impact of these variables on results .

  • Factorial design: This approach is particularly valuable when investigating how multiple factors affect Tas2r140 function. For example, a factorial design could be used to simultaneously evaluate how different compounds, concentrations, and pH levels influence receptor activation .

For dose-response studies, a systematic approach using multiple concentrations (typically 8-12, log-spaced) of test compounds is recommended, with appropriate replication (n≥3) for statistical validity. Statistical analysis using ANOVA is appropriate for comparing responses across multiple conditions .

What heterologous expression systems are recommended for functional studies of rat Tas2r140?

Based on studies with mouse bitter taste receptors, the following heterologous expression system is recommended for functional studies of rat Tas2r140:

  • Cell line: HEK293T cells are the preferred host cells for bitter taste receptor expression due to their high transfection efficiency and minimal endogenous receptor expression .

  • G-protein co-expression: Cells should be co-transfected with a chimeric G-protein, particularly Gα16gust44, which couples bitter taste receptor activation to calcium signaling. This system has been shown to provide higher sensitivity than Gα15-based assays, especially for compounds with low efficacy .

  • Expression enhancement: To improve surface expression, the addition of an N-terminal tag consisting of the first 45 amino acids of rat somatostatin receptor type 3 may enhance membrane targeting.

  • Transfection protocol:

    • Optimize DNA:transfection reagent ratios

    • Use 24-48 hour expression periods before functional assays

    • Consider generating stable cell lines for more consistent expression

This system provides a reliable platform for identifying agonists and characterizing the pharmacological properties of Tas2r140.

What functional assays are most effective for measuring Tas2r140 activation?

Several functional assays can be employed to measure Tas2r140 activation, each with specific advantages:

  • Calcium imaging assays:

    • Cells are loaded with calcium-sensitive fluorescent dyes (e.g., Fluo-4, Fura-2)

    • Receptor activation leads to calcium mobilization, detected as changes in fluorescence

    • Provides real-time kinetic information and can be performed at single-cell resolution

    • Most commonly used method for bitter taste receptor characterization

  • Inositol phosphate accumulation assays:

    • Measures production of inositol phosphates following receptor activation

    • Provides a cumulative measure of receptor activity over time

    • Less prone to transient artifacts compared to calcium imaging

  • BRET-based assays:

    • Measures direct interaction between the receptor and downstream signaling partners

    • Provides mechanistic insights into signaling pathway engagement

    • Requires genetic fusion constructs but offers high specificity

For Tas2r140, calcium imaging with Gα16gust44 co-expression is the recommended approach based on mouse studies, which have shown this system to be more sensitive for detecting responses from weakly expressed or narrowly tuned bitter taste receptors .

How can I determine the agonist profile and tuning breadth of rat Tas2r140?

To determine the agonist profile and tuning breadth of rat Tas2r140:

  • Compound selection strategy:

    • Test a diverse panel of bitter compounds (>100 recommended)

    • Include compounds from different chemical classes

    • Include compounds known to activate other Tas2r family members

    • Consider compounds relevant to rat dietary ecology

  • Screening protocol:

    • Express rat Tas2r140 in the heterologous system described above

    • Perform initial single-concentration screening to identify potential agonists

    • Follow up with full dose-response characterization of hits

    • Include appropriate positive and negative controls

  • Tuning breadth classification:
    Mouse studies have shown that Tas2r receptors vary in their breadth of tuning, with some recognizing many compounds (generalists) and others responding to only a few (specialists) . Based on these findings, tuning breadth can be classified as:

    • Narrowly tuned: responds to <10% of test compounds

    • Intermediately tuned: responds to 10-30% of test compounds

    • Broadly tuned: responds to >30% of test compounds

  • Data analysis:

    • Calculate EC₅₀ values for active compounds

    • Determine response efficacies (maximum response)

    • Generate a comprehensive agonist profile

Given that mouse Tas2r140 is one of the less abundantly expressed receptors, it may be more likely to function as a narrowly tuned specialist receptor rather than a broadly tuned generalist .

How do I address potential false positives and false negatives in Tas2r140 activation studies?

To address potential false positives and false negatives in Tas2r140 activation studies:

  • Minimizing false positives:

    • Perform counter-screening in non-transfected or vector-transfected control cells

    • Test compounds for direct effects on calcium signaling pathways

    • Include appropriate vehicle controls to account for solvent effects

    • Establish clear statistical criteria for defining "hits" (e.g., response ≥3 standard deviations above baseline)

  • Minimizing false negatives:

    • Use a system with proven sensitivity (Gα16gust44 co-expression)

    • Verify receptor expression before functional testing

    • Test compounds at multiple concentrations

    • Consider solubility issues and potential compound precipitation

  • Validation approaches:

    • Confirm key findings with independent compound preparations

    • Use multiple batches of transfected cells

    • Employ alternative functional assays for important compounds

    • Consider structure-activity relationships to support findings

  • Data analysis considerations:

    • Apply appropriate statistical tests with correction for multiple comparisons

    • Report effect sizes and confidence intervals, not just p-values

    • Consider both statistical and biological significance when interpreting results

By implementing these strategies, researchers can increase confidence in the identified agonist profile of Tas2r140.

How can I compare the pharmacological properties of rat Tas2r140 with its mouse and human orthologs?

To compare the pharmacological properties of rat Tas2r140 with its mouse and human orthologs:

  • Experimental design for cross-species comparison:

    • Express all three orthologs (rat, mouse, human) under identical conditions

    • Use the same expression vectors, host cells, and G-protein coupling

    • Test the same panel of compounds using identical assay protocols

    • Include internal standards for normalization across experiments

  • Comparative analysis approach:

    • Generate dose-response curves for active compounds at each receptor

    • Compare EC₅₀ values, efficacies, and Hill slopes

    • Identify compounds with species-selective activity

    • Create a Venn diagram showing overlapping and unique agonists

  • Factors to consider in interpretation:

    • Sequence differences in orthologous receptors often result in distinct agonist profiles

    • Species-specific gene expansions have enabled diversification of bitter substance recognition spectra

    • Mice possess fewer broadly tuned receptors and more narrowly tuned receptors compared to humans

    • Differences may reflect evolutionary adaptation to different dietary bitter compound exposures

This comparative approach can provide insights into the evolutionary conservation and divergence of bitter taste receptor function across species.

How can I identify the key residues in rat Tas2r140 responsible for ligand binding and receptor activation?

To identify key residues in rat Tas2r140 involved in ligand binding and receptor activation:

  • Homology modeling and computational approaches:

    • Generate a 3D structural model based on known GPCR structures

    • Identify potential binding pockets using cavity detection algorithms

    • Perform in silico docking of known agonists to predict binding poses

    • Identify candidate residues for experimental validation

  • Site-directed mutagenesis strategy:

    • Target residues predicted to be involved in binding from computational studies

    • Focus on conserved motifs in transmembrane domains

    • Create an alanine-scanning library targeting extracellular loops and transmembrane regions

    • Generate point mutations (conservative and non-conservative substitutions)

  • Functional characterization of mutants:

    • Express mutant receptors using the same heterologous system

    • Verify proper expression and trafficking to the cell surface

    • Test activation by a panel of agonists at multiple concentrations

    • Analyze shifts in potency (EC₅₀) and efficacy (maximum response)

  • Data interpretation:

    • Map functionally important residues onto the structural model

    • Categorize mutations based on their effects (loss of function, gain of function, altered specificity)

    • Compare with known ligand-binding residues in other bitter taste receptors

    • Develop a mechanistic model of ligand recognition and receptor activation

This systematic approach combining computational prediction and experimental validation has proven effective for other GPCRs and can provide valuable insights into the molecular basis of Tas2r140 function.

What strategies can be used to develop selective modulators of rat Tas2r140?

To develop selective modulators of rat Tas2r140:

  • Agonist development strategy:

    • Start with identified Tas2r140 agonists from screening studies

    • Perform structure-activity relationship (SAR) studies with systematic modifications

    • Focus on improving potency and selectivity over other Tas2r family members

    • Use computational modeling to guide rational design of improved compounds

  • Antagonist development approach:

    • Screen compounds for inhibition of responses to known Tas2r140 agonists

    • Test at multiple concentrations to establish dose-dependent inhibition

    • Characterize the mechanism (competitive vs. non-competitive)

    • Determine selectivity by testing against other bitter taste receptors

  • Allosteric modulator identification:

    • Screen for compounds that enhance or inhibit responses to EC₂₀ concentrations of known agonists

    • Characterize effects on potency and efficacy using full dose-response curves

    • Investigate binding sites distinct from the orthosteric site

    • Evaluate effects on receptor activation kinetics

  • Experimental design considerations:

    • Use appropriate statistical designs (factorial, randomized block) to efficiently test multiple compounds

    • Include proper controls for vehicle effects and non-specific activity

    • Establish clear criteria for defining selectivity (e.g., >10-fold difference in potency)

    • Validate findings in independent experiments

Development of selective modulators would provide valuable tools for investigating Tas2r140 function in complex systems and could have potential applications in modifying bitter taste perception.

How can I correlate in vitro findings on rat Tas2r140 with in vivo bitter taste perception?

To establish meaningful correlations between in vitro Tas2r140 data and in vivo bitter taste perception:

  • Behavioral taste assessment methods:

    • Brief-access taste tests: These measure immediate licking responses to presented solutions and are particularly valuable for assessing taste quality without post-ingestive effects

    • Two-bottle preference tests: These assess consumption preferences over longer periods but may be influenced by post-ingestive factors

    • Gustatory nerve recordings: These directly measure taste nerve responses to stimuli and provide physiological correlates

  • Experimental design for correlative studies:

    • Test compounds with varying in vitro potencies at Tas2r140

    • Use concentration ranges that span the in vitro dose-response curve

    • Include compounds selective for Tas2r140 vs. those activating multiple receptors

    • Include appropriate controls (non-bitter tastants, known bitter compounds)

  • Analysis approach:

    • Plot in vitro EC₅₀ values against behavioral thresholds

    • Calculate correlation coefficients between in vitro potency and aversion strength

    • Develop regression models to predict in vivo responses from in vitro data

    • Analyze discrepancies to identify additional factors affecting perception

  • Validation strategies:

    • Use genetic approaches when available (receptor knockout models)

    • Test predictions with novel compounds not used in developing the correlation

    • Compare findings across multiple behavioral assays

    • Consider species-specific differences in bitter taste perception

What statistical approaches are most appropriate for analyzing Tas2r140 functional data?

When analyzing Tas2r140 functional data, the following statistical approaches are recommended:

  • Dose-response analysis:

    • Fit data to four-parameter logistic equation:
      Response = Bottom + (Top-Bottom)/(1+10^((LogEC₅₀-Log[compound])*HillSlope))

    • Use non-linear regression with appropriate constraints

    • Report EC₅₀ values with 95% confidence intervals

    • Compare curves using extra sum-of-squares F test or AIC criteria

  • Analysis of variance (ANOVA):

    • For comparing responses across multiple treatments or conditions

    • Apply appropriate post-hoc tests with correction for multiple comparisons

    • Consider nested ANOVA designs when experiments have hierarchical structure

    • Use ANOVA to analyze experiments with factorial designs

  • Regression and correlation analysis:

    • For identifying relationships between structure and activity

    • Use multiple regression to account for various molecular properties

    • Apply appropriate transformations for non-linear relationships

    • Use regression diagnostics to identify influential points or outliers

  • Normalization and data pre-processing:

    • Normalize to internal standards to account for day-to-day variability

    • Consider baseline subtraction or fold-change calculations

    • Apply appropriate transformations to achieve normal distribution when needed

    • Establish consistent criteria for identifying and handling outliers

  • Visualization approaches:

    • Present scatter plots of individual data points alongside means

    • Use heat maps to visualize activity patterns across multiple compounds

    • Create clear dose-response curves with confidence intervals

    • Employ consistent and informative error bars (standard deviation or standard error)

These approaches ensure robust analysis of Tas2r140 functional data while accounting for the complexity and variability inherent in receptor activation studies.

How can I address data reproducibility challenges in Tas2r140 research?

To address reproducibility challenges in Tas2r140 research:

  • Standardization of experimental protocols:

    • Develop detailed SOPs for cell culture, transfection, and assay procedures

    • Standardize expression time and conditions post-transfection

    • Use consistent reagent sources and preparation methods

    • Implement quality control checks at critical steps

  • Experimental design strategies:

    • Use randomized block designs to account for known sources of variation

    • Include positive and negative controls in every experiment

    • Perform adequate replication (both technical and biological)

    • Consider blinding procedures when feasible

  • Data analysis and reporting practices:

    • Pre-define analysis methods and exclusion criteria

    • Report all experimental conditions in detail

    • Include measures of effect size and precision (confidence intervals)

    • Share raw data when possible

  • Validation approaches:

    • Verify key findings using independent reagent preparations

    • Confirm important results in different batches of cells

    • Use alternative assay methods for critical findings

    • Consider inter-laboratory validation for major discoveries

  • Addressing common sources of variability:

    • Monitor transfection efficiency across experiments

    • Control for variation in receptor expression levels

    • Account for differences in cell density and passage number

    • Standardize instrument settings and calibration procedures

Implementing these practices will enhance data reproducibility and confidence in findings related to rat Tas2r140 function.

How can I integrate data from different experimental approaches to build a comprehensive model of Tas2r140 function?

To build a comprehensive model of Tas2r140 function by integrating diverse experimental data:

  • Data integration framework:

    • Compile data from multiple experimental approaches (expression, functional, structural)

    • Standardize data formats and units for comparability

    • Create a unified database or spreadsheet linking all experimental results

    • Develop a consistent nomenclature for compounds, mutations, and experimental conditions

  • Multi-level data integration:

    • Molecular level: Combine mutagenesis data with structural models to define binding sites

    • Cellular level: Integrate expression patterns with functional responses

    • Physiological level: Correlate in vitro pharmacology with behavioral responses

    • Evolutionary level: Compare across species to identify conserved and divergent features

  • Computational modeling approaches:

    • Develop pharmacophore models based on agonist structural features

    • Create receptor homology models incorporating mutagenesis constraints

    • Use machine learning to identify patterns in structure-activity relationships

    • Develop predictive models of receptor activation

  • Visualization and communication strategies:

    • Create multi-dimensional visualizations to represent complex datasets

    • Develop clear conceptual models that integrate key findings

    • Use consistent color coding and symbols across different data representations

    • Present data at appropriate levels of abstraction for different audiences

  • Iterative model refinement:

    • Generate testable hypotheses from initial models

    • Design experiments specifically to address model weaknesses

    • Update models with new experimental data

    • Identify remaining gaps and prioritize future research directions

This integrative approach leverages the strengths of various experimental methodologies to develop a more complete understanding of Tas2r140 structure, function, and physiological role.

What are the current research gaps and future directions in rat Tas2r140 research?

Current research on rat Tas2r140 and bitter taste receptors in general reveals several important gaps and promising future directions. While mouse bitter taste receptors have been extensively studied, with agonists identified for 21 of 35 putative functional receptors , the specific properties of rat Tas2r140 remain less characterized. Mouse studies have demonstrated that Tas2r receptor tuning breadth varies widely, with some receptors broadly tuned and others highly selective .

For future research, several directions deserve attention. First, comprehensive deorphanization of rat Tas2r140 using diverse compound libraries would establish its agonist profile and tuning breadth. Second, comparative studies between rat, mouse, and human orthologs would illuminate evolutionary patterns in bitter taste perception. Third, structure-function analyses using mutagenesis and modeling approaches could identify key residues involved in ligand recognition and receptor activation.

How can understanding rat Tas2r140 contribute to broader taste perception research?

Second, comparative studies of Tas2r140 across species can illuminate evolutionary patterns in taste perception. Mouse studies have shown that species-specific gene expansions have enabled diversification of bitter substance recognition spectra , and understanding how rat Tas2r140 fits into this evolutionary picture can reveal principles of taste receptor adaptation to ecological niches.

Third, the methodological approaches developed for studying Tas2r140 can be applied to other taste receptors. The experimental designs described for receptor characterization , including completely randomized designs, randomized block designs, and factorial designs, provide a framework for systematic investigation of taste receptor function.

Finally, insights from Tas2r140 research can inform applications in food science, pharmaceutical development, and animal nutrition by clarifying the molecular basis of bitter taste perception in rodent models widely used in preclinical research.

By addressing these research questions and directions, scientists can develop a more comprehensive understanding of Tas2r140 function and its contribution to bitter taste perception, ultimately advancing our knowledge of sensory biology and its applications to human health and animal welfare.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.