Recombinant Rat Taste receptor type 2 member 39 (Tas2r39)

Shipped with Ice Packs
In Stock

Description

Functional Roles and Ligand Interactions

Primary Functions

  • Detects bitter compounds like theaflavins, soy isoflavones, and green tea catechins .

  • Regulates enterohormones (e.g., ghrelin, cholecystokinin) to influence food intake .

Ligand Profile

CategoryExamplesEffect on Tas2r39
AgonistsEpigallocatechin gallate (EGCG)Activation (EC₅₀: 10 μM)
Theaflavin-3-gallatePotent activation
AntagonistsApigenin, LuteolinCompetitive inhibition
Peptide AgonistsTrp-Trp, Leu-Leu-Leu tripeptidesSubtype-specific activation

Research Applications and Experimental Findings

Key Studies

  • Cell Surface Expression: Immunocytochemistry confirms extracellular localization in unpermeabilized cells, critical for functional assays .

  • Signal Transduction: Activates PLC-β2 and TRPM5 channels via gustducin, measurable via calcium imaging .

Experimental Challenges

  • Low efficacy in heterologous systems without permeabilization for some Tas2r subtypes .

  • Broad ligand selectivity complicates antagonist development .

Comparative Analysis Across Species

SpeciesReceptor NameKey Distinctions
Rat (Rattus norvegicus)Tas2r39Shares 78% sequence identity with human TAS2R39
Human (Homo sapiens)TAS2R39Involved in allergic rhinitis cytokine release
Mouse (Mus musculus)Tas2r139Specialized cycloheximide detection

Biomedical Implications

  • Gastrointestinal Research: Modulates gut-brain axis signaling, potentially targeting metabolic disorders .

  • Respiratory Studies: Linked to inflammatory responses in allergic rhinitis .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and protein stability. Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
Tas2r39; Tas2r32; Taste receptor type 2 member 39; T2R39; Taste receptor type 2 member 32; T2R32
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-319
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MAQPSNYWKQDLLPLSILILTLVATECTIGIIASGIITVVNAVSWVQKRAVSITTRILLL LSVSRIGLQSIILIEMTSSIFNFSSYNSVLYRVSRVSFVFLNYCSLWFAALLSFFHFVKI ANFSYPLFFKLKWRISELMPWLLWLSVFISFSSSMFFCNHKYTVYNNISLSSNICNFTME LYVAEANVVNVAFLFSFGILPPLTMFIATATLLIFSLRRHTLHMRNGDADSRNPRVEAHK QAIKETSCFLFLYILYAAVLFLSTSNIADASLFWSSVLRISLPVYPAGHSVLLIQSNPGL KRTWKQLLSQIHLHLQSRY
Uniprot No.

Target Background

Function
Putative taste receptor potentially involved in the perception of bitterness.
Database Links
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Tas2r39 and what is its primary function?

Tas2r39 (Taste receptor type 2 member 39) is a G protein-coupled receptor that plays a crucial role in the perception of bitterness. It belongs to the TAS2R family of bitter taste receptors, which in humans consists of 25 different receptors . The primary function of Tas2r39 is to detect potentially harmful compounds, particularly plant-derived bitter substances, serving as a protective mechanism to prevent disease by avoiding the absorption of potentially toxic components .

Functionally, Tas2r39 is gustducin-linked, meaning its activation stimulates alpha gustducin, mediates phospholipase C-beta-2 (PLC-beta-2) activation, and leads to the gating of TRPM5 (Transient receptor potential cation channel subfamily M member 5) . This signaling cascade is essential for transducing bitter taste perception.

Where is Tas2r39 expressed beyond the oral cavity?

While initially thought to be restricted to taste buds, Tas2r39 has been identified in multiple extraoral tissues:

Tissue/SystemDetection MethodReference
Gastrointestinal tractGene expression
Respiratory systemGene expression, Protein detection
Nervous system (choroid plexus)Protein detection
Reproductive systemGene expression
Pancreas and spleenDatabase records
BrainDatabase records
Testes and ovariesDatabase records

This extraoral expression pattern suggests that Tas2r39 serves functions beyond taste perception, including potential roles in sensing the chemical composition of gastrointestinal content and modulating bacterial infection in the upper airway by regulating innate immune responses .

What are the recommended methods for detecting Tas2r39 expression in tissue samples?

Detection of Tas2r39 in tissue samples can be challenging due to its relatively low expression levels . The following methodological approaches are recommended:

  • Gene Expression Analysis:

    • RT-PCR with gene-specific primers

    • RNA-Seq for quantitative expression profiling

    • In situ hybridization for tissue localization

  • Protein Detection:

    • Western blot using validated antibodies (e.g., ab138199 for human TAS2R39, which may cross-react with rat Tas2r39 based on sequence homology)

    • Immunohistochemistry for tissue localization

    • ELISA for quantification in tissue lysates

  • Functional Analysis:

    • Calcium imaging assays using Tas2r39-expressing cells

    • Receptor activation assays measuring downstream signaling molecules

For optimal results, researchers should verify expression using at least two complementary techniques, as detection can be difficult due to the low expression levels in non-gustatory tissues .

How can researchers assess Tas2r39 activation in functional assays?

Several approaches can be used to measure Tas2r39 activation:

  • Calcium Mobilization Assays:

    • Transfect cells (typically HEK293 cells) with Tas2r39 and the G protein component Gα16gust44

    • Load cells with calcium-sensitive fluorescent dyes (e.g., Fluo-4 AM)

    • Measure intracellular calcium changes upon ligand addition using fluorescence plate readers or imaging systems

    • Include positive controls (known Tas2r39 agonists) and negative controls

  • Reporter Gene Assays:

    • Utilize luciferase or other reporter constructs driven by elements responsive to Tas2r39 signaling

    • Measure luminescence following receptor activation

  • BRET/FRET-Based Assays:

    • Construct fusion proteins with appropriate donor/acceptor pairs

    • Monitor conformational changes upon receptor activation

  • Electrophysiological Techniques:

    • Patch-clamp recordings from Tas2r39-expressing cells

    • Measure changes in membrane potential or current

When comparing efficacies of different ligands, normalize responses to well-characterized agonists as demonstrated in the work with human TAS2R39, where bile acid responses were compared to established agonists like denatonium benzoate .

What are the key considerations when working with recombinant Rat Tas2r39 protein?

When working with recombinant Rat Tas2r39 protein, researchers should consider the following:

  • Storage and Stability:

    • Store at -20°C/-80°C upon receipt

    • Aliquot to avoid repeated freeze-thaw cycles

    • After reconstitution, store working aliquots at 4°C for up to one week

  • Reconstitution Protocol:

    • Briefly centrifuge the vial before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add 5-50% glycerol (recommended final concentration: 50%) for long-term storage

  • Buffer Compatibility:

    • The recombinant protein is typically supplied in Tris/PBS-based buffer with 6% Trehalose, pH 8.0

    • For functional assays, buffer compatibility should be tested

  • Quality Control:

    • Verify purity (>90% by SDS-PAGE)

    • Confirm identity via Western blot using anti-His antibodies

    • Test functionality with appropriate binding or activity assays

  • Expression System Considerations:

    • E. coli-expressed proteins lack post-translational modifications

    • For certain applications, consider mammalian or insect cell-expressed Tas2r39

What compounds are known to activate Tas2r39 and how does their efficacy compare?

Tas2r39 is a relatively non-selective receptor that can be activated by various compounds, primarily plant-derived substances. Based on studies with human TAS2R39 (which shares homology with rat Tas2r39), the following compounds act as agonists:

Compound ClassExamplesActivation ThresholdSpecificity
TheaflavinsTheaflavin, Theaflavin-3,3-O'-digalatteLow micromolarPreferential for TAS2R39
CatechinsVarious catechinsLow to mid micromolarLess specific
IsoflavonesAcetylgenistin, Genistin, Glycitin, Malonyl genistinLow micromolarSpecific to TAS2R39
FlavonoidsAcacetin, 5,2′-dihydroxyflavone, Gardenin A, Genkwanin, Gossypetin, 6-methoxyflavonol, 4′-hydroxyflavanoneVariedSome specific to TAS2R39
Other compoundsVanillinMid micromolarLower specificity
Dipeptides/TripeptidesTrp-Trp, Leu-Trp, Trp-Trp-Trp, Leu-Leu-LeuMid micromolarSome specificity
Bile acidsLithocholic acid, Taurolithocholic acidLow micromolarActivates multiple TAS2Rs

For human TAS2R39, bile acid responses were considerably stronger than those elicited by the standard control stimulus denatonium benzoate .

When comparing efficacies, researchers should use standardized assay conditions and reference compounds to normalize responses across experiments.

What are the known antagonists of Tas2r39 and how do they function?

Unlike the numerous agonists identified for Tas2r39, few antagonists have been characterized. From studies on human TAS2R39, the following compounds display antagonistic properties:

CompoundStructure ClassInhibitory EffectSpecificity
6,3'-dimethoxyflavanoneFlavanoneStrong inhibitionPreferential for TAS2R39
4'-fluoro-6-methoxyflavanoneFlavanoneStrong inhibitionPreferential for TAS2R39
6-methoxyflavanoneFlavanoneModerate inhibitionLess specific

Structural analysis reveals key features required for antagonist activity:

  • A methoxy group on position 6 of the A ring is mandatory

  • The absence of a double bond in the C ring of the structure

  • Antagonists display stereochemical flexibility, which fills the binding pocket and prevents conformational changes necessary for receptor activation

These antagonists function by competitively binding to the receptor without triggering the conformational changes required for signal transduction. The binding involves a combination of hydrophobic interactions and hydrogen bonding similar to agonists, but the structural differences prevent receptor activation .

How does the binding pocket of Tas2r39 accommodate different ligands?

The binding pocket of TAS2R39 exhibits significant versatility in accommodating different ligands. Based on computational modeling and structure-activity relationship studies:

This flexible binding pocket explains the receptor's ability to respond to a diverse range of chemical structures while maintaining some degree of selectivity.

How does Tas2r39 function in extraoral tissues and what are the physiological implications?

Tas2r39 exhibits diverse functions beyond taste perception when expressed in extraoral tissues:

  • Gastrointestinal Tract:

    • Regulates enterohormone secretion, potentially influencing food intake and satiety

    • May monitor quorum sensing molecules from intestinal flora

    • Could play a role in detecting parasites that emit TAS2R agonists

  • Respiratory System:

    • May be involved in the congestion process of allergic rhinitis

    • Can stimulate inflammatory cytokine production

    • Potentially modulates bacterial infection in the upper airway

    • Could mediate immune responses to both endogenous and exogenous compounds entering the lungs

  • Other Systems:

    • In the nervous system (choroid plexus), may sense chemical composition of cerebrospinal fluid

    • Potential roles in reproductive tissues remain to be elucidated

These extraoral functions suggest that Tas2r39 acts as a chemical sensor beyond taste perception, contributing to broader chemosensory surveillance throughout the body. The evolutionary conservation of these receptors across species indicates their fundamental importance in detecting potentially harmful compounds and triggering protective physiological responses.

Future research should focus on tissue-specific signaling pathways and physiological outcomes of Tas2r39 activation in these diverse contexts.

How do variants in the Tas2r39 gene affect receptor function and physiological responses?

While limited data exists specifically for rat Tas2r39 genetic variants, research on TAS2R genes across species provides insights into how genetic variation might impact Tas2r39 function:

  • Impact on Ligand Recognition:

    • Nonsynonymous variants in TAS2R genes can alter receptor sensitivity to specific bitter compounds

    • Changes in key residues within the binding pocket may enhance or diminish responses to particular ligand classes

  • Physiological Consequences:

    • Variants in related TAS2R genes have been associated with:

      • Altered taste perception and food preferences

      • Changes in body mass index and metabolic parameters

      • Susceptibility to respiratory infections

      • Responses to toxins and carcinogens

  • Species-Specific Adaptation:

    • Evolutionary analysis suggests that TAS2R genes have undergone positive selection, likely reflecting adaptation to different ecological niches and dietary patterns

    • Variation between species (e.g., human vs. rat Tas2r39) may reflect differences in diet and environmental exposures

  • Functional Heterogeneity:

    • Population genetics studies of TAS2R genes reveal hundreds of nonsynonymous variants, suggesting extensive functional heterogeneity in bitter taste perception across populations

    • This variation likely extends to extraoral functions of these receptors

For researchers investigating rat Tas2r39 variants, approaches should include:

  • Comparative sequence analysis across rat strains

  • Functional characterization of variants using in vitro expression systems

  • Correlation of genotypes with physiological phenotypes in vivo

  • Consideration of species-specific differences when extrapolating from human studies

What expression systems are optimal for producing functional recombinant Rat Tas2r39?

Different expression systems offer distinct advantages for producing recombinant Rat Tas2r39:

Expression SystemAdvantagesLimitationsBest Applications
E. coli- High yield
- Cost-effective
- Simple scale-up
- Lacks post-translational modifications
- May form inclusion bodies
- Challenging for full-length membrane proteins
- Peptide fragments for antibody production
- Structural studies of soluble domains
Yeast- Post-translational modifications
- Higher yield than mammalian cells
- Cost-effective
- Glycosylation pattern differs from mammals
- May require codon optimization
- Binding studies
- Structural analyses
Insect cells- More native-like glycosylation
- Good for membrane proteins
- Higher expression than mammalian cells
- More complex than bacterial systems
- Requires baculovirus vectors
- Functional studies
- Purification of intact receptor
Mammalian cells- Most physiological post-translational modifications
- Native-like membrane environment
- Better folding for complex proteins
- Lower yields
- Higher cost
- More technically demanding
- Cell-based functional assays
- Signaling studies
- Interaction analyses

When expressing Tas2r39 in heterologous systems, consider:

  • Including chaperones or partner proteins to improve folding

  • Using inducible promoters to control expression levels

  • Adding appropriate tags for detection and purification (e.g., His-tag)

  • Optimizing codons for the expression host

  • Including solubilization agents for membrane protein extraction

What are the critical quality control parameters for recombinant Rat Tas2r39 protein?

Ensuring the quality of recombinant Rat Tas2r39 is essential for reliable research outcomes. Critical quality control parameters include:

  • Purity Assessment:

    • SDS-PAGE analysis (>90% purity recommended)

    • Size-exclusion chromatography for aggregation analysis

    • Mass spectrometry for accurate molecular weight determination

  • Identity Confirmation:

    • Western blot with anti-Tas2r39 or anti-tag antibodies

    • Peptide mass fingerprinting

    • N-terminal sequencing

  • Structural Integrity:

    • Circular dichroism spectroscopy for secondary structure analysis

    • Fluorescence spectroscopy for tertiary structure assessment

    • Thermal stability assays (e.g., differential scanning fluorimetry)

  • Functional Activity:

    • Ligand binding assays using known Tas2r39 agonists

    • For membrane-integrated receptor, calcium mobilization assays

    • Conformational change assays upon ligand binding

  • Stability Assessment:

    • Accelerated stability testing under different conditions

    • Freeze-thaw cycle stability

    • Long-term storage stability at recommended temperatures (-20°C/-80°C)

How does Rat Tas2r39 compare structurally and functionally to human TAS2R39?

Rat Tas2r39 and human TAS2R39 share fundamental similarities but also exhibit important differences:

Structural Comparison:

  • Human TAS2R39 consists of 338 amino acids, while rat Tas2r39 has 319 amino acids

  • Both possess the characteristic seven transmembrane domain structure of GPCRs

  • Sequence homology analysis suggests conserved binding pocket architecture

  • Key residues involved in ligand binding are likely preserved across species

Functional Similarities:

  • Both function as bitter taste receptors linked to gustducin signaling

  • Both are expressed in extraoral tissues, suggesting broader physiological roles

  • Both are relatively non-selective receptors that respond to multiple ligand classes

Key Differences:

  • Human TAS2R39 has been more extensively characterized in terms of ligand specificity

  • Response profiles to specific bitter compounds may differ between species

  • Extraoral expression patterns may vary, reflecting species-specific physiological adaptations

Evolutionary Considerations:

  • TAS2R genes show evidence of positive selection across species, likely reflecting adaptation to different ecological niches and dietary patterns

  • Species-specific bitter taste perception may have evolved in response to local plant toxins and dietary adaptations

For researchers working with rat models, understanding these similarities and differences is crucial when extrapolating findings to human physiology or when using rat Tas2r39 as a model for human TAS2R39.

What methods are recommended for cross-species functional comparison of Tas2r39?

To effectively compare Tas2r39 function across species, researchers should employ a systematic approach:

  • Sequence and Structure Analysis:

    • Multiple sequence alignment to identify conserved and divergent regions

    • Homology modeling based on available structures (e.g., TAS2R46 as template)

    • Prediction of functional domains and binding sites

    • Phylogenetic analysis to understand evolutionary relationships

  • Comparative Expression Analysis:

    • Parallel RT-qPCR or RNA-Seq across equivalent tissues from different species

    • Cross-species tissue microarrays with validated antibodies

    • Single-cell RNA-Seq to identify cell-specific expression patterns

  • Heterologous Expression Systems:

    • Express Tas2r39 orthologs from different species in the same cellular background

    • Use identical assay conditions and readout systems

    • Compare response profiles to a standardized panel of bitter compounds

    • Analyze dose-response relationships and efficacy parameters

  • Chimeric Receptor Approaches:

    • Create chimeric receptors swapping domains between species

    • Identify regions responsible for species-specific pharmacological profiles

    • Site-directed mutagenesis of non-conserved residues

  • In Vivo Functional Studies:

    • Develop comparable behavioral assays across species

    • Use transgenic approaches for cross-species complementation

    • Consider knock-in models expressing the human receptor in rodent models

When comparing human and rat data, researchers should account for:

  • Differences in receptor expression levels in native tissues

  • Potential variations in downstream signaling pathways

  • Species-specific physiological contexts

  • Different evolutionary pressures that may have shaped receptor function

This systematic approach allows for meaningful translation of findings between species while identifying important functional divergence that may impact experimental interpretation.

How are new structural determination techniques advancing our understanding of Tas2r39?

Recent breakthroughs in structural biology are revolutionizing our understanding of taste receptors, including Tas2r39:

  • Cryo-Electron Microscopy Advances:

    • Experimental structures for two bitter taste receptors (TAS2R46 and TAS2R14) have been determined using cryo-EM

    • These structures serve as improved templates for homology modeling of Tas2r39

    • Revealed previously unknown features, such as intracellular ligand binding sites in TAS2R14

    • Opened new opportunities for detailed structural analysis of the entire receptor family

  • AI-Based Structure Prediction:

    • AlphaFold and related deep learning methods now predict protein structures with atomic accuracy

    • These predicted structures are available via databases like EBI

    • Complement experimental approaches and provide structural insights for receptors lacking experimental structures

  • Integrative Structural Biology Approaches:

    • Combining computational predictions with experimental data

    • Hydrogen-deuterium exchange mass spectrometry for mapping ligand-induced conformational changes

    • Cross-linking mass spectrometry to identify spatial relationships between domains

  • Molecular Dynamics Simulations:

    • All-atom simulations of receptor-ligand complexes in membrane environments

    • Enhanced sampling techniques to study conformational changes associated with activation

    • Calculation of binding free energies for various ligands

These advanced techniques are enabling researchers to:

  • Better understand the structural basis of Tas2r39 ligand specificity

  • Identify allosteric binding sites beyond the orthosteric pocket

  • Elucidate the molecular mechanisms of receptor activation

  • Design more selective agonists and antagonists

  • Predict the functional impact of genetic variants

As these methods continue to evolve, our structural understanding of Tas2r39 will become increasingly precise, facilitating more targeted approaches in both basic and applied research.

What are the emerging therapeutic applications of Tas2r39 research?

Research on Tas2r39 and related bitter taste receptors is revealing potential therapeutic applications across multiple disease areas:

  • Respiratory Disorders:

    • TAS2R activation in airway smooth muscle causes bronchodilation

    • Potential applications in asthma and chronic obstructive pulmonary disease

    • TAS2R39's role in modulating bacterial infection in the upper airway suggests applications in respiratory infections

  • Gastrointestinal Disorders:

    • Regulation of enterohormone secretion suggests applications in appetite control and metabolic disorders

    • Potential role in irritable bowel syndrome through modulation of gut motility

    • Sensing of bile acids by TAS2Rs suggests applications in biliary disorders

  • Immune Modulation:

    • Involvement in inflammatory cytokine production indicates potential anti-inflammatory applications

    • Role in innate immune response regulation suggests antimicrobial applications

  • Metabolic Disorders:

    • Evidence from related TAS2Rs indicates potential roles in glucose regulation

    • Association with food intake and preference suggests applications in obesity management

    • Detection of intestinal flora may offer applications in microbiome-related disorders

  • Drug Delivery and Formulation:

    • Understanding Tas2r39 activation can improve palatability of bitter medications

    • Rational design of compounds that avoid Tas2r39 activation while maintaining therapeutic efficacy

    • Development of selective Tas2r39 blockers to mask bitter taste in pharmaceuticals

Emerging therapeutic strategies include:

  • Development of selective Tas2r39 agonists for respiratory applications

  • Design of antagonists for taste-masking applications

  • Exploitation of extraoral Tas2r39 expression for targeted drug delivery

  • Combination approaches targeting multiple TAS2Rs for enhanced efficacy

As our understanding of Tas2r39 biology continues to expand, additional therapeutic applications are likely to emerge across various medical fields.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.