Recombinant Rat Taste receptor type 2 member 40 (Tas2r40)

Shipped with Ice Packs
In Stock
Cat. No.
BT2062966
Source
in vitro E.coli expression system
Synonyms
Tas2r40; T2r18; Taste receptor type 2 member 40; T2R40; Taste receptor type 2 member 18; T2R18
Quick Inquiry

Description

Introduction to Recombinant Rat Taste Receptor Type 2 Member 40 (Tas2r40)

Recombinant Rat Taste Receptor Type 2 Member 40 (Tas2r40) is a laboratory-engineered protein that replicates the native rat bitter taste receptor. As a member of the TAS2R family, Tas2r40 is a G protein-coupled receptor (GPCR) involved in detecting bitter compounds, which play roles in dietary responses and toxin avoidance . Recombinant versions enable functional studies, ligand screening, and structural analyses without requiring native tissue extraction .

Recombinant Production and Purification

Recombinant Tas2r40 is synthesized using heterologous expression systems to ensure high yield and purity:

ParameterDetails
Expression SystemsMammalian cells (e.g., HEK293), E. coli (for partial domains) .
TagsStrep-tag, His-tag, or Fc-fusion for purification and detection .
StorageTris-based buffer with 50% glycerol; stable at -20°C or -80°C .

Sequence (Partial):
MAIITTDSDYYTHRYEVIIPFVVSTIDCIVGIIGNGFITVIYGTELVRSKRLPTGEHLmL...

Research Applications

Recombinant Tas2r40 is utilized in diverse experimental contexts:

ApplicationDescription
Ligand ScreeningIdentifies bitter compounds via calcium flux or GTPγS binding assays .
Structural StudiesFacilitates cryo-EM or X-ray crystallography to resolve activation mechanisms.
ELISA/Western BlotQuantifies expression levels in tissue samples (e.g., Commercial ELISA kits) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Tas2r40; T2r18; Taste receptor type 2 member 40; T2R40; Taste receptor type 2 member 18; T2R18
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-319
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Tas2r40
Target Protein Sequence
MAIITTDSDYYTHRYEVIIPFVVSTIDCIVGIIGNGFITVIYGTELVRSKRLPTGEHLML MLSFSRLLLQIWIMVEITYQLFFPMIYNHNAMYKLFKTISVFLNYCNLWFAAWLNVFYCL KIVNFAHPLFLMMKQKIVVLMPRLMSLSVLVSISLSSFFSKDIFNVYMNTSVPIPFSNST KMKYFFKTNVLNLAFLYYMGIFIPLFMFIMAAILLITSLKRHTLNMESSTTGSRDSSMEA HLGAIKSTSYSLILYIINALALFISMSNIFGAYSTWNSVCSFILTAYPAGQSVHLILRNP GLRRAWRRFQHHVRLYLKR
Uniprot No.
Q67ET2

Target Background

Function

Gustducin-coupled receptor involved in the detection of bitter compounds within the oral cavity and gastrointestinal tract. It signals through PLCB2 and the calcium-regulated cation channel TRPM5.

Database Links

KEGG: rno:500101

STRING: 10116.ENSRNOP00000033127

UniGene: Rn.152216

Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.