Recombinant Rat Taste receptor type 2 member 41 (Tas2r41)

Shipped with Ice Packs
In Stock

Description

Functional Insights and Signaling Mechanisms

Tas2r41 is implicated in bitter taste perception, though its rat-specific ligands remain under investigation. Insights from human TAS2R41 studies suggest a role in detecting antibiotics like chloramphenicol, a "specialist" agonist .

Bitter Signal Transduction Pathway:

  1. Ligand Binding: Bitter compounds interact with extracellular/transmembrane domains.

  2. G-Protein Activation: Triggers gustducin-mediated phospholipase C-β2 (PLC-β2) activation, leading to IP3_3-dependent calcium release .

  3. Downstream Effects: Calcium influx via TRPM5 channels depolarizes cells, prompting ATP release through CALHM1 channels to activate afferent nerves .

Cell Surface Localization (Inferred from Mouse Orthologs)

Studies on murine Tas2r receptors reveal variability in cell surface expression, which impacts functional assays :

ReceptorSurface Staining (Unpermeabilized)Intracellular Staining (Permeabilized)
Tas2r105++
Tas2r118++
Tas2r131+

Data adapted from mouse Tas2r studies . Rat Tas2r41 is hypothesized to exhibit similar trafficking patterns.

Ligand Specificity and Agonist Identification

  • Chloramphenicol: Activates human TAS2R41 at EC50_{50} ~30 μM . Genetic variants (e.g., L127P) reduce sensitivity by ~10-fold .

  • Sucralose: Bitter aftertaste in humans linked to TAS2R41 activation, suggesting conserved roles in aversive compound detection .

Applications in Research

Recombinant Tas2r41 is utilized in:

  • Drug Development: Screening bitter-masking agents for pharmaceuticals .

  • Functional Assays:

    • Calcium imaging to map receptor activation .

    • Western blot (WB) and ELISA for expression validation .

  • Structural Studies: Molecular dynamics simulations to probe ligand-binding pockets .

Challenges and Future Directions

  • Deorphanization: No confirmed agonists for rat Tas2r41; reliance on cross-species inferences .

  • Expression Optimization: Low surface expression in heterologous systems (e.g., HEK293) complicates assays .

  • Evolutionary Context: Amphibian TAS2R expansions suggest ecological adaptations; similar diversification may exist in rodents .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes and we will fulfill it to the best of our ability.
Lead Time
Delivery times may vary depending on the purchase method and location. For precise delivery estimates, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs. For dry ice shipping, please contact us in advance for an additional fee.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which serves as a reference point.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to minimize freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us and we will prioritize its development.
Synonyms
Tas2r41; Tas2r12; Taste receptor type 2 member 41; T2R41; T2R12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MLSTVSVFFMSIFVLLCFLGILANGFIVLMLSREWLWRGRLLPSDMILLSLGTSRFCQQC VGLVNSFYYSLHLVEYSRSLARQLISLHMDFLNSATFWFGTWLSVLFCIKIANFSHPAFL WLKWRFPALVPWLLLGSILVSFIVTLMFFWGNHTVYQAFLRRKFSGNTTFKEWNRRLEID YFMPLKLVTTSIPCSLFLVSILLLINSLRRHSQRMQHNAHSLQDPNTQAHSRALKSLISF LVLYALSYVSMVIDATVVISSDNVWYWPWQIILYLCMSVHPFILITNNLKFRGTFRQLLL LARGFWVT
Uniprot No.

Target Background

Function
This receptor is potentially involved in the perception of bitterness and is linked to gustducin. It may play a role in sensing the chemical composition of gastrointestinal content. The activation of this receptor could stimulate alpha gustducin, mediate PLC-beta-2 activation, and ultimately lead to the gating of TRPM5.
Database Links
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in subsets of taste receptor cells of the tongue and palate epithelium and exclusively in gustducin-positive cells. Expressed in 15% taste bud cells in circumvallate and foliate papillae but only in 2% in fungiform papillae. Expressed in the duo

Q&A

What is Tas2r41 and how does it function in taste perception?

Tas2r41 is a G protein-coupled receptor (GPCR) belonging to the Taste 2 Receptor (T2R) family responsible for bitter taste perception. Like other T2Rs, it contains seven transmembrane domains and is primarily expressed in taste receptor cells of the tongue and palate epithelia . When activated by bitter compounds, Tas2r41 initiates an intracellular signaling cascade that ultimately leads to the perception of bitter taste.

In the context of evolutionary biology, bitter taste receptors like Tas2r41 serve as critical components in an animal's defense mechanism against potentially toxic compounds. The variable numbers of taste 2 receptor genes expressed in gustatory end organs enable vertebrates to recognize numerous bitter chemicals, with receptor repertoires evolving to match the profiles of bitter compounds encountered in species-specific diets .

How does rat Tas2r41 compare structurally to its human and mouse orthologs?

While the search results don't provide specific information about rat Tas2r41, comparative analysis with human and mouse orthologs reveals important insights. The human TAS2R41 gene is an intronless gene located on chromosome 7, clustered with eight other taste receptor genes . The gene encodes a seven-transmembrane receptor protein that functions specifically as a bitter taste receptor.

Studies of bitter taste receptors across species show that orthologous receptors (those derived from a common ancestral gene) often have distinct agonist profiles despite sequence similarities . For example, sequence-orthologous bitter taste receptors between humans and mice demonstrate different activation patterns by bitter compounds. This suggests that while the rat Tas2r41 likely shares structural similarities with mouse and human orthologs, its functional properties may be species-specific, reflecting evolutionary adaptations to different ecological niches and dietary exposures.

What are the known agonists for Tas2r41 across species?

The agonist profile of Tas2r41 varies across species, reflecting evolutionary adaptations to different ecological niches:

For human TAS2R41:

  • Chloramphenicol has been identified as a primary agonist

  • Sucralose (a non-nutritive sweetener) has also been identified as a ligand

This suggests that human TAS2R41 is relatively narrowly tuned compared to other TAS2Rs, as only two agonists have been identified to date .

For mouse Tas2r41, the search results don't provide specific agonist information, but comparative studies of mouse bitter taste receptors reveal that they vary greatly in their breadth of tuning, ranging from very broadly to extremely narrowly tuned receptors .

Based on comparative research, we can infer that rat Tas2r41 may also have a specific agonist profile, potentially overlapping with but distinct from its human and mouse counterparts. Research suggests that mice possess fewer broadly tuned receptors and more narrowly tuned receptors compared to humans, supporting the idea that larger receptor repertoires facilitate the evolution of specialized receptors .

What is the expression pattern of Tas2r41 in taste tissues?

While specific information about rat Tas2r41 expression isn't provided in the search results, insights can be gained from studies of other Tas2r family members. In mice, expression levels of different Tas2r genes vary considerably in taste tissues. For example, some receptors like Tas2r118 show strong expression in qRT-PCR experiments and pronounced staining in in situ hybridization, while others like Tas2r115 and Tas2r120 exhibit lower mRNA levels and fainter signals in in situ hybridization .

Generally, T2R receptors are predominantly expressed in taste receptor cells of the tongue and palate epithelia . When studying rat Tas2r41 expression, researchers should consider evaluating both mRNA levels through qRT-PCR and cellular localization through in situ hybridization, as these methods provide complementary information about receptor expression patterns.

How do genetic polymorphisms affect Tas2r41 function?

Genetic polymorphisms significantly impact Tas2r41 function, potentially altering both ligand specificity and receptor sensitivity. For human TAS2R41, a specific genetic variant has been identified that dramatically affects receptor function:

  • The L127P polymorphism in human TAS2R41 results in approximately 10-fold reduction in response for the L127 variant compared to the P127 variant when stimulated by chloramphenicol

  • This functional difference is so significant that early research using the less responsive L127 variant failed to identify chloramphenicol as an agonist for TAS2R41

This finding highlights the critical importance of considering genetic variants when studying taste receptor function. For rat Tas2r41, researchers should investigate whether similar functional polymorphisms exist and how they might affect receptor activation patterns.

The functional consequences of these polymorphisms extend beyond basic receptor pharmacology, potentially influencing behavioral responses to bitter compounds. For instance, TAS2R38 variants are associated with variable bitterness perception of chloramphenicol and propylthiouracil (PROP), while TAS2R9 variants (V187A) are linked to differential perception of ofloxacin bitterness, with the A187 variant being the functionally active form .

How does Tas2r41 signaling integrate with other bitter taste pathways?

Bitter taste perception involves complex signaling networks with multiple receptors responding to the same compounds and individual receptors recognizing multiple ligands. This creates a sophisticated coding system for bitter taste perception:

  • Redundant receptor activation: Many bitter compounds activate multiple Tas2r receptors. For example, quinine activates seven mouse Tas2r receptors with similar potencies (thresholds between 3.0 and 10 μM) .

  • Graded concentration responses: Some compounds activate different receptors at distinct concentration thresholds. For instance, saccharin activates mouse Tas2r135, Tas2r105, Tas2r109, and Tas2r144 with threshold concentrations of 0.1, 1.0, 3.0, and 10 mM, respectively . This creates a graded bitter response as concentration increases.

  • Receptor-specific agonists: Despite overlapping activation profiles, each Tas2r responds to a unique combination of compounds. Eight mouse Tas2rs have specific cognate agonists not detected by other receptors .

For researchers studying rat Tas2r41, understanding its place within this integrated signaling network is essential. Determining which compounds specifically activate rat Tas2r41, which other rat Tas2rs respond to the same compounds, and how these signaling pathways converge to produce the final sensory perception represents an important research direction.

What methodological approaches are most effective for functional characterization of recombinant Tas2r41?

Several methodological approaches have proven effective for the functional characterization of recombinant taste receptors:

  • Heterologous expression systems: Studies typically express recombinant taste receptors in cell lines (commonly HEK293T cells) that do not endogenously express these receptors . This approach allows for controlled examination of receptor function.

  • Calcium imaging: This technique measures intracellular calcium levels as a proxy for receptor activation. When bitter compounds activate the receptor, it triggers a signaling cascade that results in calcium release, which can be measured using fluorescent calcium indicators .

  • Dose-response analyses: Determination of threshold concentrations, EC50 values, and maximum response amplitudes provides comprehensive characterization of receptor-ligand interactions. This approach has revealed that different agonists activate mouse Tas2r with widely varying efficacies and potencies .

For rat Tas2r41 specifically, researchers should consider:

  • Testing a broad panel of bitter compounds at multiple concentrations

  • Including compounds known to activate human TAS2R41 (chloramphenicol, sucralose)

  • Comparing multiple genetic variants if polymorphisms are identified

  • Using appropriate controls to verify the specificity of responses

What is the evolutionary significance of species differences in Tas2r41 function?

Species differences in Tas2r41 function reflect evolutionary adaptations to different ecological niches and dietary exposures to bitter compounds. Research comparing mouse and human bitter taste receptors provides valuable insights:

  • Species-specific tuning breadth: Mice possess fewer broadly tuned receptors and more narrowly tuned receptors compared to humans, suggesting that large receptor repertoires facilitate the evolution of specialized receptors .

  • Differential agonist profiles of orthologous receptors: Despite sequence similarities, orthologous receptors in different species often respond differently to the same compounds. For example, propylthiouracil (PROP) primarily activates one receptor (TAS2R38) in humans but activates six different Tas2r receptors in mice .

  • Selective pressure on receptor repertoires: The repertoire of bitter taste receptors in each species likely evolved to detect potentially harmful compounds in their specific environments and diets .

For rat Tas2r41, understanding its evolutionary relationship to mouse and human orthologs can provide insights into its function and the selective pressures that shaped its properties. Comparative studies examining the responses of rat, mouse, and human orthologs to the same panel of bitter compounds would be particularly informative.

What expression systems are most suitable for studying recombinant rat Tas2r41?

Selecting an appropriate expression system is crucial for the functional characterization of recombinant Tas2r41:

  • HEK293T cells: This human embryonic kidney cell line is commonly used for expressing taste receptors due to its high transfection efficiency and ease of culture. For example, studies of mouse and human bitter taste receptors have successfully employed HEK293T cells to characterize receptor responses to various bitter compounds .

  • Co-expression with signaling components: G protein-coupled receptors like Tas2r41 require appropriate G proteins for signal transduction. Co-expression with components like Gα16-gust44 (a chimeric G protein) facilitates coupling to downstream calcium signaling pathways that can be readily measured .

  • Expression optimization: Optimizing expression vectors, codon usage, signal sequences, and culture conditions may be necessary to achieve functional expression of rat Tas2r41. Some taste receptors express poorly in heterologous systems and may require modifications to enhance surface expression.

When establishing an expression system for rat Tas2r41, researchers should:

  • Verify protein expression through methods such as Western blotting or immunofluorescence

  • Include positive controls (receptors known to function in the expression system)

  • Test multiple expression constructs if initial attempts yield poor functional responses

How can researchers effectively measure Tas2r41 activation in experimental settings?

Several techniques are available for measuring Tas2r41 activation, each with specific advantages:

  • Calcium imaging using fluorescent indicators:

    • Enables real-time monitoring of receptor activation

    • Can be performed at single-cell resolution or in cell populations

    • Allows for quantification of both response magnitude and kinetics

  • Reporter gene assays:

    • Provide integrated measures of receptor activation over time

    • May offer improved sensitivity for weakly responding receptors

    • Allow for high-throughput screening applications

  • Electrophysiological recordings:

    • Offer high temporal resolution of receptor-mediated responses

    • Can detect rapid events that might be missed by other methods

    • More technically demanding than other approaches

For optimal characterization of rat Tas2r41:

  • Establish full concentration-response relationships for identified agonists

  • Determine both threshold concentrations and EC50 values

  • Quantify efficacy (maximum response amplitude) for different agonists

  • Include appropriate positive and negative controls

What experimental controls are essential when characterizing rat Tas2r41?

Proper experimental controls are crucial for reliable characterization of rat Tas2r41:

  • Vehicle controls:

    • Include matched solvent controls for all test compounds

    • Account for potential non-specific effects of vehicles (especially for compounds dissolved in DMSO or ethanol)

  • Receptor expression controls:

    • Mock-transfected cells to control for endogenous responses

    • Cells expressing well-characterized receptors as positive controls

    • Verification of receptor expression levels through protein detection methods

  • Functional validation controls:

    • Include compounds known to activate similar receptors (e.g., human TAS2R41 agonists)

    • Test concentration ranges spanning at least 3-4 orders of magnitude

    • Verify reproducibility across multiple independent experiments

  • Genetic variant controls:

    • If studying polymorphic variants, ensure matched expression levels

    • Include both active and inactive variants when available

    • Consider species orthologs as comparative controls

A systematic approach using these controls will enhance the reliability and interpretability of results from rat Tas2r41 characterization studies.

What are the technical challenges in producing functional recombinant Tas2r41?

Researchers face several technical challenges when producing functional recombinant Tas2r41:

  • Low expression levels: GPCRs often express poorly in heterologous systems. Optimization strategies may include:

    • Codon optimization for the expression system

    • Addition of signal sequences to enhance membrane targeting

    • Use of expression tags that promote proper folding and trafficking

  • Receptor misfolding: Taste receptors may not fold correctly in heterologous systems, resulting in non-functional protein. Approaches to address this include:

    • Culturing cells at lower temperatures to slow protein synthesis

    • Addition of chemical chaperones to the culture medium

    • Use of specialized cell lines with enhanced protein folding capacity

  • Coupling to signaling machinery: Efficient coupling to G proteins is essential for functional assays. Strategies include:

    • Co-expression of chimeric G proteins engineered to couple efficiently to taste receptors

    • Optimization of the ratio of receptor to G protein expression

    • Use of cell lines with suitable endogenous G protein expression

  • Compound solubility and stability: Many bitter compounds have limited solubility in aqueous solutions and may degrade during experimental procedures. Researchers should:

    • Carefully prepare and store test compounds according to established protocols

    • Verify compound stability under experimental conditions

    • Use appropriate vehicles and concentration ranges to avoid precipitation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.