Recombinant Rat Taste receptor type 2 member 4 (Tas2r4)

Shipped with Ice Packs
In Stock

Description

Definition and Basic Characteristics

Recombinant Rat Tas2r4 refers to the full-length, 304-amino acid protein (UniProt ID: Q67ET0) expressed in E. coli with an N-terminal His tag . Key features include:

PropertyDetail
Gene IDTas2r4 (Rat Genome Database: RGD 1342891)
Protein ClassG protein-coupled receptor (GPCR)
Molecular Weight~34 kDa (theoretical)
Expression SystemE. coli
TagPolyhistidine (His-tag) for purification

Bitter Taste Signaling

  • Mediates bitter compound detection (e.g., denatonium benzoate)

  • Couples with gustducin Gα subunit to trigger Ca²⁺ signaling

Extraoral Roles

Tissue/SystemFunctionMechanism
MyometriumUterine relaxation via Ca²⁺ inhibition Blocks oxytocin-induced contractions
Breast CancerTumor suppression via MAPK/ERK1/2 pathways Reduces proliferation and migration
BrainNeuromodulation (exact role under investigation) Expressed in cortical neurons

Expression Challenges

  • Cell Surface Localization:

    • 75% of tested Tas2r proteins showed surface expression in HEK cells without permeabilization :

    ReceptorSurface Expression (Unpermeabilized)Permeabilized
    Tas2r4++
    Tas2r102-+
    Tas2r131-+

Genetic Variations

  • SNP rs2234001 (C>T) alters ligand sensitivity

  • Haplotype TGAG correlates with heightened bitter perception

Preclinical Studies

  • Preterm Birth Prevention:

    • Tas2r4 activation outperformed standard tocolytics in murine models (50% reduction in preterm labor)

  • Cancer Therapy:

    • Tas2r4 agonists induced apoptosis in breast cancer cells at EC₅₀ = 12.5 μM

Drug Delivery Systems

  • TAS2R-targeted liposomes demonstrated:

    • 3.8x increased tumor accumulation vs. untargeted controls

    • 62% reduction in pancreatic tumor growth

Research Limitations

  • Agonist Specificity: 10 mM PROP required for Tas2r4 activation vs. 0.3 mM for TAS2R38

  • Structural Data: Predicted models lack experimental validation via X-ray crystallography

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please clearly indicate your preferred format in the order notes, and we will prepare the product accordingly.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for precise delivery information.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference for your own preparations.
Shelf Life
The shelf life of the product is influenced by several factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
Tas2r4; T2r16; T2r20; Taste receptor type 2 member 4; T2R4; T2R16; Taste receptor type 2 member 20; T2R20
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-304
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MLWELYAFVFAASVVFNFVGIVANLFIIVIISKTWVKSHKISSSDKILFSLAITRFLTLG LFLLNTVYIATNTGRSVYFSTFFLLCWKFLDSNSLWLVTFLNCLYCVKITHFQHPVFLLL KRTVSMKTTSLLLACLLISAFTTLLYFVLTQISRFPEHIIGRNDTLFDVSDGILTLAASL ILSSLLQFLLNVTFASLLIHSLRRHVQKMQRNRSSFWNPQTEAHVGAMRLMICFLVLYIP YSIAALLYFPSYMRKNLRAQAACMIITAAYPPGHSILLIITHHKLKAKAKKICCFYKLRD FVSN
Uniprot No.

Target Background

Function
Gustducin-coupled receptor implicated in the perception of bitter compounds in the oral cavity and the gastrointestinal tract. Signals through PLCB2 and the calcium-regulated cation channel TRPM5. In airway epithelial cells, binding of denatonium increases the intracellular calcium ion concentration and stimulates ciliary beat frequency.
Database Links
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium membrane.
Tissue Specificity
Expressed in tongue, stomach and duodenum.

Q&A

What is the structural organization of Rat Tas2r4?

Rat Tas2r4 belongs to the G protein-coupled receptor superfamily characterized by a 7-transmembrane domain architecture. Like other TAS2R family members, it is encoded by an intronless gene and specifically expressed in taste receptor cells of the tongue and palate epithelia. The protein functions as a bitter taste receptor with a relatively short extracellular N-terminus (typically 1-30 amino acid residues) lacking inherent signal peptide sequences . Importantly, Tas2r4 contains a conserved N-glycosylation site in the second extracellular loop that has been demonstrated to be critical for receptor trafficking to the cell surface .

How does Tas2r4 signaling cascade function?

When studying Tas2r4 signaling, researchers should understand that upon ligand binding, the receptor undergoes conformational changes that activate associated G proteins. In native taste cells, this typically involves gustducin, while in heterologous expression systems, chimeric G proteins like Gα16-gust44 are often utilized to couple receptor activation with phospholipase C, leading to intracellular calcium release from the endoplasmic reticulum . To quantify this activation experimentally, bioluminescent calcium sensors such as mt-clytin II can be employed to produce measurable signals proportional to receptor activation .

What experimental challenges are associated with Tas2r4 expression?

Expressing functional Tas2r4 presents several challenges for researchers. The native receptor typically displays poor trafficking to the plasma membrane in heterologous expression systems. This limitation can be overcome by incorporating N-terminal signal sequences from other GPCRs, with common options including rat somatostatin receptor type 3 (SST3) or rhodopsin (Rho) signal sequences . Recent research indicates that the M3 muscarinic receptor signal sequence may provide superior trafficking for certain TAS2Rs . Additionally, the receptor must be efficiently coupled to second messenger systems to produce detectable signals, which can be accomplished through co-expression with chimeric G proteins specifically designed for taste receptor studies .

What expression systems optimize recombinant Tas2r4 functionality?

For optimal recombinant Tas2r4 expression, mammalian cell systems are strongly preferred over bacterial or insect cell systems due to their appropriate post-translational modification machinery. Human embryonic kidney cell lines like AD-293 or 293AD have demonstrated strong adherent properties that facilitate media changes during functional assays . When designing expression vectors, researchers should consider incorporating three critical components: (1) the full-length Tas2r4 gene modified with an appropriate N-terminal signal sequence, (2) a Gα16-gust44 chimera for functional coupling to phospholipase C, and (3) a calcium-sensitive reporter such as mt-clytin II . For consistent co-expression, multigene vector systems derived from commercial kits like MultiBacMam can be employed to ensure uniform expression patterns across cell populations, which significantly improves assay reproducibility compared to co-transfection approaches .

How can cell surface trafficking of Tas2r4 be enhanced?

Enhancing Tas2r4 cell surface expression is crucial for developing sensitive functional assays. Research indicates that N-terminal signal sequences from various GPCRs differ in their ability to promote Tas2r4 trafficking to the plasma membrane. While SST3 and rhodopsin signal sequences have been traditionally used, screening of signal sequences from 55 Class A non-olfactory GPCRs revealed that the M3 muscarinic receptor signal sequence produced larger assay windows for certain TAS2Rs . This superiority may stem from the introduction of additional N-glycosylation sites, which can improve receptor folding . A methodological approach would involve:

  • Generating multiple Tas2r4 constructs with different signal sequences

  • Evaluating surface expression through either fluorescence microscopy of tagged receptors or functional calcium mobilization assays

  • Comparing signal-to-noise ratios in functional assays to identify optimal constructs

  • Validating findings with multiple known Tas2r4 agonists across concentration ranges

What are the most reliable functional assays for Tas2r4 activation?

Bioluminescence-based intracellular calcium release assays represent the current gold standard for measuring Tas2r4 activation. These assays offer advantages over fluorescence-based methods due to higher signal-to-noise ratios and reduced false positives from compound autofluorescence . Implementation requires:

  • Transfection of cells with a multigene construct containing Tas2r4, Gα16-gust44, and mt-clytin II

  • Preparation of appropriate control cells expressing only mt-clytin II or both Gα16-gust44 and mt-clytin II without Tas2r4

  • Testing of dose-dependent responses to known agonists

  • Analysis of EC50 values to determine receptor functionality

Using this methodology, researchers can generate reliable dose-response curves that are comparable to previously published data, though some variations in EC50 values may occur due to differences in assay formats, cell lines, and ligand preparations .

How do environmental chemicals modulate Tas2r4 expression and function?

Tas2r4 expression is modulated by various environmental chemicals, providing an important area for toxicological and pharmacological investigation. Based on experimental evidence, several compounds have demonstrated specific effects on Tas2r4 expression levels:

ChemicalEffect on Tas2r4Experimental Evidence
Epigallocatechin 3-gallateIncreases expression (with potassium chromate co-treatment)EXP
2,3,7,8-tetrachlorodibenzodioxineIncreases expressionEXP
Lactic acid (2-hydroxypropanoic acid)Increases expressionEXP
Aristolochic acid AIncreases expressionEXP
Benzo[a]pyreneIncreases expression and mutagenesisEXP
Bisphenol AContradictory effects (both decrease and increase reported)ISO (using Rattus norvegicus Tas2r108)
ChlorpyrifosIncreases expressionISO (using Mus musculus Tas2r108)

Researchers investigating these interactions should employ RT-qPCR to quantify changes in mRNA expression levels following treatment with these compounds. Additionally, functional assays should be conducted to determine whether expression changes correlate with alterations in receptor sensitivity or efficacy.

What molecular mechanisms underlie the pharmacological profile of Tas2r4?

Understanding the molecular basis of Tas2r4 pharmacology requires consideration of both orthosteric binding sites for primary bitter compounds and potential allosteric modulatory sites. When designing studies to investigate Tas2r4 pharmacology, researchers should:

  • Test a panel of known TAS2R4 agonists including stevioside and various metal ions (Mg²⁺, Mn²⁺, Zn²⁺)

  • Generate full dose-response curves to determine both potency (EC50) and efficacy (maximum response)

  • Compare results between different expression systems and with different signal sequence tags

  • Control for non-specific activation by testing compounds on cells lacking Tas2r4 expression

Research has shown that EC50 values obtained from bioluminescence-based assays are generally comparable to published literature values, though some deviations have been observed for specific ligands including stevioside and metal ions . These variations likely reflect differences in assay formats, readout methods, cell lines, and ligand preparations rather than fundamental differences in receptor pharmacology.

How should multigene expression vectors be designed for optimal Tas2r4 studies?

The design of multigene expression vectors is critical for consistent Tas2r4 functional studies. A methodological approach includes:

  • Utilizing vector systems like MultiBacMam that allow assembly of multiple expression cassettes within a single plasmid

  • Incorporating three essential genes under separate promoters:

    • Tas2r4 with an appropriate signal sequence under CMV promoter

    • Gα16-gust44 under CAG promoter

    • mt-clytin II calcium sensor under CAG promoter

  • Using Cre-loxP recombination to assemble the multigene vector with 1:1:1 stoichiometry

  • Confirming correct assembly through restriction enzyme analysis (e.g., BstXI digestion)

This approach overcomes limitations associated with co-transfection of separate plasmids, which often results in heterogeneous cell populations with variable expression levels of each component. The resulting improved assay reproducibility is essential for pharmacological characterization and high-throughput screening applications .

What controls are essential for validating Tas2r4 functional assays?

Proper experimental controls are essential for distinguishing specific Tas2r4 activation from non-specific effects. At minimum, researchers should include:

  • Cells expressing only the calcium sensor (mt-clytin II) to control for direct calcium mobilization by test compounds

  • Cells expressing both the G protein (Gα16-gust44) and calcium sensor without Tas2r4 to control for activation of endogenous receptors

  • Full dose-response curves for known Tas2r4 agonists as positive controls

  • Vehicle controls to establish baseline response levels

When properly implemented, these controls should show flat or non-dose-dependent calcium responses when challenged with Tas2r4 agonists, confirming that observed responses in Tas2r4-expressing cells reflect specific receptor activation rather than non-specific effects on endogenous GPCRs, calcium channels, or cellular effectors .

How does Rat Tas2r4 compare with homologs from other species?

Comparing Rat Tas2r4 with homologs from other species provides valuable insights into evolutionary conservation and functional adaptations. Recombinant Tas2r4/TAS2R4 proteins have been produced from multiple species including human, mouse, rat, and various non-human primates (Pan troglodytes, Papio hamadryas, Pan paniscus, Pongo pygmaeus, and Gorilla gorilla gorilla) . When conducting comparative studies, researchers should consider:

  • Sequence conservation in key functional domains

  • Differences in glycosylation patterns

  • Species-specific pharmacological profiles

  • Variations in cell surface trafficking requirements

These comparative analyses can help identify conserved regions critical for function versus variable regions that may contribute to species-specific taste preferences or sensitivities to bitter compounds.

What evolutionary insights can be gained from studying Tas2r4?

Evolutionary studies of Tas2r4 can provide insights into dietary adaptations and selective pressures across species. The human TAS2R4 gene is clustered with three other taste receptor genes on chromosome 7 and is genetically linked to loci that influence bitter perception . Researchers investigating evolutionary aspects should:

  • Conduct phylogenetic analyses of Tas2r4 sequences across species

  • Correlate sequence variations with known dietary preferences

  • Examine evidence of positive selection in specific domains

  • Consider the co-evolution of Tas2r4 with downstream signaling components

Such studies can contribute to our understanding of how bitter taste perception has evolved as a protective mechanism against potentially toxic compounds in different ecological niches.

What emerging technologies might advance Tas2r4 research?

Several emerging technologies hold promise for advancing Tas2r4 research:

  • CRISPR-Cas9 genome editing for creating precise modifications in endogenous Tas2r4

  • Cryo-electron microscopy for determining the three-dimensional structure of Tas2r4

  • Advanced biosensors that provide real-time measurement of receptor conformational changes

  • Single-cell transcriptomics to examine the heterogeneity of Tas2r4 expression in taste tissues

  • Computational modeling and molecular dynamics simulations to predict ligand binding and receptor activation

Researchers entering this field should consider how these technologies might be integrated into their experimental approaches to address current limitations in understanding Tas2r4 function and regulation.

How might Tas2r4 research contribute to broader scientific knowledge?

Beyond its role in taste perception, Tas2r4 research has implications for multiple scientific disciplines:

  • Pharmacology: Understanding bitter taste receptors may facilitate the development of taste-masked pharmaceuticals

  • Toxicology: Tas2r4 responses to environmental chemicals may serve as biomarkers for exposure

  • Evolutionary biology: Comparative studies of Tas2r4 can illuminate dietary adaptations

  • Drug discovery: Tas2r4 expression in non-gustatory tissues suggests potential roles beyond taste

Researchers should consider these broader implications when designing studies and interpreting results, as findings may have significance beyond the immediate field of taste research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.