Recombinant Rat Tetraspanin-12 (Tspan12)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rat Tetraspanin-12 (Tspan12)

Recombinant Rat Tspan12 is generated using expression systems like E. coli or mammalian cells (e.g., HEK293) to produce high-purity protein for biochemical and cellular assays. It retains the native structure of rat Tspan12, including its large extracellular loop (LEL), which mediates interactions with ligands such as Norrin (NDP) and receptors like FZD4 (frizzled 4) .

Key Features:

PropertyDescription
GeneTspan12 (Tetraspanin 12)
Protein StructureFour transmembrane domains; large extracellular loop (LEL) with disulfide bonds .
Molecular Weight~30–35 kDa (varies based on post-translational modifications) .
Expression SystemsE. coli, HEK293, or mammalian cells .
TagsHis-tag, GST, or Fc tags for purification and detection .

The LEL of Tspan12 is critical for binding Norrin, with a dissociation constant (KdK_d) of ~10.4 nM measured via biolayer interferometry . Disease-associated mutations (e.g., E170K in Tspan12 or R121W in Norrin) disrupt this interaction, impairing β-catenin signaling .

Norrin/β-Catenin Signaling Pathway

Tspan12 acts as a co-receptor for Norrin, enhancing FZD4-LRP5/6 complex formation to activate β-catenin signaling. This pathway is essential for:

  • Retinal angiogenesis: Intraretinal capillary formation during development .

  • BRB maintenance: Preventing immunoglobulin leakage and edema in adult retinas .

  • Disease models: Mutations in Tspan12 are linked to familial exudative vitreoretinopathy (FEVR) and diabetic retinopathy .

Cancer and Stromal Interactions

Tspan12 upregulation in cancer-associated fibroblasts promotes invasiveness and proliferation of cancer cells via CXCL6 chemokine signaling . Recombinant Tspan12 has been used to study its role in ADAM10 and MT1-MMP activation, which facilitate tumor progression .

In Vitro Studies

  • Protein interaction assays: Tspan12 LEL fused to antibodies captures Norrin from conditioned media .

  • Signaling modulation: Overexpression rescues defective Norrin mutants (e.g., NDP C95R) in reporter assays .

In Vivo Models

  • BRB studies: Endothelial-specific Tspan12 knockout mice show BRB breakdown, IgG leakage, and cystoid edema .

  • Therapeutic testing: Anti-Tspan12 antibodies reduce pathological angiogenesis in oxygen-induced retinopathy models .

Key Research Findings

Study FocusKey OutcomeReference
BRB maintenanceTspan12 loss in adult mice causes BRB defects without vascular regression.
Norrin bindingTspan12 LEL binds Norrin with high affinity (Kd=10.4±1.2K_d = 10.4 \pm 1.2 nM).
Cancer progressionTspan12 in fibroblasts enhances cancer invasiveness via CXCL6 upregulation.
Therapeutic antibodyAnti-Tspan12 antibodies reduce retinal neovascularization by ~33%.

Technical Considerations

  • Antibody challenges: Traditional antibody development is difficult due to Tspan12’s small size and high human-mouse homology. Phage display libraries are used to generate specific antibodies .

  • Activity assays: Functional validation requires lipid nanodisc reconstitution to preserve native conformation .

  • Storage: Stable at -80°C in glycerol-based buffers .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All protein shipments are accompanied by standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. Lyophilized form maintains a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to minimize freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag preference, please inform us, and we will prioritize its development.
Synonyms
Tspan12; Tm4sf12; Tetraspanin-12; Tspan-12; Transmembrane 4 superfamily member 12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-305
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Tspan12
Target Protein Sequence
MAREDSVKCLRCLLYALNLLFWLMSISVLAVSAWMRDYLNNVLTLTAETRVEEAVILTYF PVVHPVMIAVCCFLIIVGMLGYCGTVKRNLLLLAWYFGTLLVIFCVELACGVWTYEQEVM VPVQWSDMVTLKARMTNYGLPRYRWLTHAWNYFQREFKCCGVVYFTDWLEMTEMDWPPDS CCVREFPGCSKQAHQEDLSDLYQEGCGKKMYSFLRGTKQLQVLRFLGISIGVTQILAMIL TITLLWALYYDRREPGTDQMLSLKNDASQHLSCHSVELLKPSLSRIFEHTSMANSFNTHF EMEEL
Uniprot No.

Target Background

Function
Tetraspanin-12 (Tspan12) is a regulator of cell surface receptor signal transduction. It plays a pivotal role in retinal vascularization by modulating norrin (NDP) signal transduction. Tspan12 acts in concert with norrin (NDP) to promote FZD4 multimerization and subsequent activation of FZD4, leading to an increase in beta-catenin (CTNNB1) accumulation and stimulation of LEF/TCF-mediated transcriptional programs. Notably, Tspan12 exclusively activates the norrin (NDP)-dependent activation of FZD4, without affecting Wnt-dependent activation of FZD4. This observation suggests the existence of a Wnt-independent signaling pathway that also promotes beta-catenin (CTNNB1) accumulation. Tspan12 functions as a regulator of membrane proteinases, including ADAM10 and MMP14/MT1-MMP. It activates ADAM10-dependent cleavage of amyloid precursor protein (APP) and MMP14/MT1-MMP-dependent cleavage activity.
Database Links

KEGG: rno:362326

UniGene: Rn.2146

Protein Families
Tetraspanin (TM4SF) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Tetraspanin-12 (Tspan12) and what are its key structural features?

Tspan12 belongs to the tetraspanin family of membrane proteins characterized by four transmembrane domains along with a small extracellular loop (SEL) and a large extracellular loop (LEL). The LEL is particularly important as it mediates many protein-protein interactions and is implicated in Tspan12's biological functions . Structurally, tetraspanins like Tspan12 organize into nanodomains in the plasma membrane where they modulate diverse cellular processes by binding to other membrane proteins, influencing their trafficking, localization, conformation, and ligand recruitment . Tspan12 can form both homodimers with itself and heterodimers with other proteins like Frizzled-4 (Fzd4) .

What are the primary biological functions of Tspan12?

Tspan12 has several well-documented biological functions across different cellular contexts:

  • It functions as a co-receptor for Norrin in the Norrin/β-catenin signaling pathway, enhancing signal transduction by directly capturing Norrin and increasing its local concentration .

  • In endothelial cells, Tspan12 promotes vascular morphogenesis and is essential for blood-retina barrier (BRB) formation during development and maintenance in adult mice .

  • In the adrenal cortex, Tspan12 acts as a negative regulator of aldosterone production, with its expression inversely correlated with plasma aldosterone concentrations .

  • Tspan12 plays a critical role in the Norrin-Fzd4-LRP5/6 signaling pathway, which is essential for retinal vascular development .

How does recombinant Tspan12 differ from endogenous Tspan12 in experimental systems?

Recombinant Tspan12 typically contains only the large extracellular loop (LEL) domain, whereas endogenous Tspan12 includes all transmembrane domains and intracellular regions. The LEL domain of Tspan12 has been shown to capture Norrin from conditioned media when grafted onto an antibody . When designing experiments with recombinant Tspan12, researchers should consider that while the LEL retains many binding capabilities, the lack of membrane integration may affect protein-protein interactions that depend on Tspan12's transmembrane domains or intracellular regions. Additionally, post-translational modifications might differ between recombinant and endogenous forms, potentially affecting binding affinities and functional outcomes.

What are the recommended methods for studying Tspan12-protein interactions in vitro?

Several methodological approaches have proven effective for studying Tspan12 interactions:

  • Nanodisc incorporation: Inserting Tspan12 alone or Tspan12/Fzd4 heterodimers into nanodiscs containing phospholipids (e.g., 5% PI(4,5)P2) allows for controlled assessment of protein interactions in a membrane-like environment .

  • Co-immunoprecipitation (co-IP): Tspan12 has been successfully studied using co-IP experiments to detect interactions with Fzd4 and Norrin .

  • Bioluminescence resonance energy transfer (BRET): This technique has been utilized to demonstrate that Tspan12 forms homodimers and heterodimers with Fzd4 in cells .

  • Surface plasmon resonance (SPR): For direct binding studies, SPR can quantitatively measure the binding affinity between purified Tspan12 (particularly the LEL domain) and potential interaction partners.

  • AlphaFold modeling with mutagenesis validation: Computational modeling followed by experimental validation through mutagenesis has proven effective in determining specific residues involved in Tspan12-protein interactions .

How can I optimize the expression and purification of recombinant rat Tspan12?

For optimal expression and purification of recombinant rat Tspan12:

What model systems are most appropriate for studying Tspan12 function?

Based on current research, these model systems have proven valuable for studying different aspects of Tspan12 function:

  • Conditional knockout mice: Endothelial cell-specific inactivation of Tspan12 using Cdh5-CreERT2 drivers has successfully revealed Tspan12's role in vascular development and blood-retina barrier formation .

  • Cell lines:

    • HAC15 human adrenocortical cells for studying Tspan12's role in aldosterone regulation

    • Endothelial cell lines for vascular function studies

    • HEK293 cells for Norrin/β-catenin signaling studies

  • Nanodiscs: Reconstitution of Tspan12 in nanodiscs provides a controlled membrane environment for biochemical studies .

  • Porcine models: Pig adrenal glands under dietary sodium modulation have been used to study Tspan12 regulation in response to renin-angiotensin system activation .

How does Tspan12 mechanistically enhance Norrin-mediated β-catenin signaling?

Current research indicates that Tspan12 enhances Norrin-mediated β-catenin signaling through a "capture and hand-off" mechanism rather than direct enhancement of Norrin-Fzd4 affinity. The process appears to work as follows:

  • Tspan12 directly binds Norrin via its LEL domain with relatively high affinity .

  • This binding increases the local concentration of Norrin near the cell surface, particularly in proximity to Fzd4 receptors, with which Tspan12 co-localizes .

  • Tspan12 then transfers ("hands off") the captured Norrin to nearby Fzd4 receptors, a process facilitated by the negative cooperativity between Norrin-Fzd4 and Norrin-Tspan12 binding .

  • Importantly, Tspan12 competes with LRP5/6 for Norrin binding, suggesting it does not remain bound to Norrin in a quaternary complex with Fzd4 and LRP5/6 co-receptors .

  • This model explains why Tspan12 enhances signaling at low Norrin concentrations but can inhibit signaling when overexpressed, as seen in TopFlash signaling assays showing a bell-shaped response curve to transfected Tspan12 .

What are the potential reconciliations for divergent findings regarding Tspan12's role in different signaling pathways?

Several seemingly contradictory findings regarding Tspan12 function can be reconciled:

  • Tissue-specific roles: Tspan12 functions as a co-receptor for Norrin/β-catenin signaling in vascular tissues while acting as a negative regulator of aldosterone production in adrenocortical tissues . These divergent functions likely reflect tissue-specific protein partners and signaling contexts.

  • Concentration-dependent effects: At moderate levels, Tspan12 enhances Norrin signaling by increasing local ligand concentration, but at high levels, it can sequester Norrin away from LRP5/6, explaining the bell-shaped response curve observed in signaling assays .

  • Temporal regulation: During development, Tspan12 is essential for vascular morphogenesis, but in mature vessels, it becomes dispensable for vascular maintenance while remaining critical for barrier function . This suggests developmental stage-specific roles.

  • Signaling pathway cross-talk: Tspan12's involvement in both Norrin/β-catenin signaling and aldosterone regulation suggests potential cross-talk between these pathways that may resolve apparent contradictions when considered in an integrated signaling network.

How might post-translational modifications affect Tspan12 function and interactions?

Post-translational modifications likely play critical roles in regulating Tspan12 function:

  • Glycosylation: As a transmembrane protein with extracellular domains, Tspan12 may undergo N-linked glycosylation, potentially affecting its binding properties with partners like Norrin. Researchers should consider using glycosylation site prediction tools and glycosylation inhibitors to assess the functional impact.

  • Palmitoylation: Many tetraspanins undergo palmitoylation at cysteine residues, which regulates their incorporation into tetraspanin-enriched microdomains. Experimental approaches using palmitoylation inhibitors or cysteine mutagenesis could reveal the importance of this modification for Tspan12 function.

  • Phosphorylation: Tetraspanins can be phosphorylated by various kinases. Given that Tspan12 is involved in signaling pathways and can recruit kinases intracellularly , phosphorylation may regulate its signaling capabilities. Phosphoproteomic analysis of Tspan12 under different signaling conditions would help identify regulatory phosphorylation sites.

  • Ubiquitination: This modification could regulate Tspan12 membrane levels through endocytosis and degradation, potentially explaining some of the concentration-dependent effects observed in signaling assays.

How can I effectively study the role of Tspan12 in vascular development and blood-retina barrier formation?

To study Tspan12's role in vascular development and blood-retina barrier (BRB) formation:

  • Timing of genetic manipulation: Use inducible systems like tamoxifen-inducible Cdh5-CreERT2 to target Tspan12 at specific developmental stages. Early recombination reveals roles in vascular morphogenesis, while late-induced recombination isolates BRB maintenance functions .

  • Vascular morphogenesis assessment techniques:

    • Whole-mount retinal immunostaining with CD31/PECAM-1 antibodies

    • Confocal microscopy for 3D visualization of vascular networks

    • Quantification of vascular parameters (branch points, vessel diameter, area coverage)

  • BRB integrity assessment:

    • IgG extravasation assays to detect barrier leakage

    • Tracer injection studies (e.g., fluorescent dextrans of different sizes)

    • Assessment of tight junction protein expression and localization (ZO-1, claudin-5, occludin)

    • Electroretinogram to measure functional consequences of BRB breakdown

  • Molecular readouts:

    • RNA-Seq analysis to identify dysregulated pathways (particularly ECM components)

    • Immunostaining for complement deposition as a marker of chronic barrier dysfunction

    • Assessment of cystoid edema using OCT imaging

What analytical approaches can reliably measure Tspan12-mediated effects on Norrin/β-catenin signaling?

For quantitative assessment of Tspan12's effects on Norrin/β-catenin signaling:

  • TOPFlash reporter assays: This luciferase-based system provides a quantitative readout of β-catenin-dependent transcriptional activity. Testing varying concentrations of Tspan12 can reveal both enhancing and inhibitory effects, as demonstrated by the bell-shaped response curve .

  • Direct binding measurements:

    Experimental ApproachApplicationKey Controls
    Surface Plasmon ResonanceMeasure binding kinetics between purified componentsInclude LRP5/6 competition assays
    Bioluminescence Resonance Energy TransferAssess protein-protein interactions in live cellsInclude negative control pairs
    Nanodisc IncorporationStudy interactions in membrane contextVary phospholipid composition
  • Live-cell imaging approaches:

    • TIRF microscopy to visualize Tspan12-Norrin-Fzd4 interactions at the plasma membrane

    • FRAP (Fluorescence Recovery After Photobleaching) to assess mobility and clustering of Tspan12

    • Single-molecule tracking to observe the "hand-off" model in action

  • Western blot analysis of downstream effectors:

    • Phosphorylated LRP5/6

    • Stabilized (non-phosphorylated) β-catenin

    • Target gene expression (e.g., Axin2, Lef1)

What considerations are important when designing experiments to study Tspan12's role in aldosterone regulation?

When investigating Tspan12's role in aldosterone regulation:

  • Experimental systems selection:

    • HAC15 human adrenocortical cells provide a well-established model

    • Primary adrenocortical cells from rats offer a more physiological system

    • In vivo models with dietary sodium modulation to activate the renin-angiotensin system

  • Key experimental manipulations:

    • Gene silencing approaches (siRNA, shRNA, CRISPR/Cas9) to reduce Tspan12 expression

    • Overexpression systems to increase Tspan12 levels

    • Angiotensin II stimulation (10 nM for 6 hours has been shown effective)

    • Calcium channel blockers (nifedipine) or calmodulin inhibitors (W-7) to elucidate signaling mechanisms

  • Critical measurements:

    • Aldosterone concentration in cell culture supernatants or plasma (radioimmunoassay or ELISA)

    • Expression of aldosterone synthase (CYP11B2) via qPCR and Western blot

    • Calcium signaling using fluorescent indicators

    • Localization of Tspan12 within adrenal zona glomerulosa using immunohistochemistry

  • Data analysis considerations:

    Analytical ApproachApplicationExample
    Correlation analysisRelate Tspan12 expression to aldosterone levelsR=-0.47 observed in APA cohort
    Time-course experimentsDetermine temporal relationship between Tspan12 expression and aldosterone productionMeasure at 3, 6, 12, 24 hours
    Dose-response curvesEstablish quantitative relationship between Tspan12 levels and aldosterone outputUse graded gene silencing

What are common pitfalls when working with recombinant Tspan12 and how can they be addressed?

Common challenges and their solutions include:

  • Protein aggregation: Tetraspanins can aggregate during purification due to their hydrophobic nature.

    • Solution: Use mild detergents (DDM, CHAPS) and include 10% glycerol in buffers. Purify at 4°C and minimize freeze-thaw cycles.

  • Low protein expression: Membrane proteins often express poorly in recombinant systems.

    • Solution: Consider expressing just the LEL domain fused to a carrier protein like Fc or optimize codon usage for the expression system. Test multiple cell types (HEK293, CHO, Expi293).

  • Non-specific binding in interaction studies: The hydrophobic nature of tetraspanins can lead to false positives.

    • Solution: Include appropriate detergent concentrations in binding buffers and use stringent controls, including binding to unrelated proteins with similar biochemical properties.

  • Inconsistent activity in functional assays: Batch-to-batch variation can occur.

    • Solution: Develop quantitative quality control assays (e.g., SPR binding to known partners) and establish minimum acceptance criteria for each batch.

  • Difficulty detecting protein in Western blots: Membrane proteins can be challenging to transfer efficiently.

    • Solution: Use specialized transfer conditions for membrane proteins (longer transfer times, different buffer compositions) and consider native PAGE instead of SDS-PAGE for certain applications.

How can contradictory results between in vitro and in vivo Tspan12 studies be reconciled?

When facing discrepancies between in vitro and in vivo results:

  • Consider microenvironmental factors: The membrane environment is critical for tetraspanin function. In vitro systems may lack the complex membrane composition and organization found in vivo.

    • Solution: Use more sophisticated membrane mimetics such as nanodiscs with physiologically relevant lipid compositions or native membrane vesicles.

  • Evaluate protein partner availability: In vivo, Tspan12 functions within a complex network of interactions. In vitro systems may lack important co-factors.

    • Solution: Systematically add potential co-factors to in vitro systems or use cell-based assays with known partner expression profiles.

  • Assess concentration differences: The bell-shaped response curve observed with Tspan12 suggests concentration-dependent effects that might differ between in vitro and in vivo settings.

    • Solution: Perform careful titration experiments in both systems to identify concentration-dependent switches in behavior.

  • Examine temporal dynamics: Some effects of Tspan12 may be transient or dependent on specific developmental stages .

    • Solution: Use time-course experiments and inducible systems to capture temporal aspects of Tspan12 function.

What are promising therapeutic applications for modulating Tspan12 function?

Several therapeutic applications emerge from current Tspan12 research:

  • Retinal vascular diseases: Given Tspan12's role in blood-retina barrier formation and maintenance , therapeutic strategies targeting Tspan12 could address conditions like diabetic retinopathy and retinopathy of prematurity. Approaches might include:

    • Small molecule stabilizers of Tspan12-Fzd4 interactions

    • Tspan12 mimetics that enhance Norrin-Fzd4 signaling

  • Hypertension management: As a negative regulator of aldosterone production , Tspan12 activators could potentially reduce aldosterone levels in primary aldosteronism, offering an alternative to current mineralocorticoid receptor antagonists.

  • Cancer therapy: Many tetraspanins are implicated in cancer progression. Although not directly addressed in the provided search results, Tspan12's role in signaling pathways like Wnt/β-catenin suggests potential applications in cancers where these pathways are dysregulated.

  • Blood-brain barrier modulation: Given the similarities between blood-retina and blood-brain barriers, Tspan12-based approaches might be relevant for CNS drug delivery or treating neurodegenerative diseases with barrier dysfunction components.

What technical innovations would advance our understanding of Tspan12 biology?

To deepen our understanding of Tspan12 biology, these technical innovations would be valuable:

  • Advanced imaging approaches:

    • Super-resolution microscopy to visualize Tspan12 within tetraspanin-enriched microdomains

    • Single-molecule tracking to directly observe the proposed "hand-off" mechanism between Tspan12 and Fzd4

    • Cryo-electron microscopy to determine the structure of Tspan12 in complex with its binding partners

  • Proteomics applications:

    • Proximity labeling approaches (BioID, APEX) to identify the complete Tspan12 interactome in different cell types

    • Phosphoproteomics to identify signaling pathways regulated by Tspan12

    • Cross-linking mass spectrometry to map interaction interfaces

  • Genetic engineering tools:

    • Development of tissue-specific and inducible Tspan12 knockout/knockin models

    • CRISPR-based screens to identify novel genes that modify Tspan12 function

    • Optogenetic approaches to spatiotemporally control Tspan12 activity

  • Computational methods:

    • Machine learning algorithms to predict Tspan12 interaction partners across different tissues

    • Molecular dynamics simulations to understand Tspan12 membrane dynamics and interactions

    • Systems biology approaches to model Tspan12's role in integrating multiple signaling pathways

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.