Recombinant Rat Tetraspanin-17 (Tspan17)

Shipped with Ice Packs
In Stock

Description

Research Applications of Recombinant Rat Tspan17

Recombinant Tspan17 enables mechanistic studies of its roles in:

  • Protein maturation: Facilitates ADAM10 trafficking to the cell surface, influencing ectodomain shedding of substrates like amyloid precursor protein (APP) .

  • Cellular signaling: Modulates pathways linked to apoptosis, proliferation, and migration via tetraspanin-enriched microdomains (TEMs) .

Gene-Chemical Interactions in Rat Models

The Rat Genome Database highlights Tspan17's responsiveness to environmental and pharmacological compounds :

CompoundEffect on Tspan17Experimental Context
1,2-DimethylhydrazineDecreases expressionColorectal cancer model
Benzo[a]pyreneIncreases expressionCarcinogen exposure
Valproic AcidIncreases methylationNeurodevelopmental studies
DoxorubicinDecreases expressionChemotherapy response
Nickel SulfateIncreases expressionHeavy metal toxicity

Functional Knockdown Studies

  • siRNA-mediated Tspan17 suppression reduced mRNA and protein levels by >90% in rat-derived cell lines, correlating with inhibited proliferation and increased apoptosis .

  • Co-treatment with miR-378a-3p antagomir and Tspan17 siRNA partially restored oncogenic phenotypes in glioma models .

Implications in Disease Pathogenesis

  • Cancer: Elevated Tspan17 correlates with tumor size, advanced WHO grade, and poor survival in glioblastoma (GBM) .

  • Neurodegeneration: Through ADAM10 regulation, Tspan17 may influence APP processing and amyloid-beta production .

Current Research Gaps

  • In vivo validation: Most studies use cell lines; rodent xenograft models are needed to confirm Tspan17’s role in tumorigenesis .

  • Structural studies: The exact mechanism of Tspan17-ADAM10 interaction remains uncharacterized .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly indicate them in your order remarks. We will strive to fulfill your requests.
Lead Time
The delivery time may vary based on your purchasing method and location. For precise delivery estimates, please consult your local distributor.
All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please communicate your request in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquotation for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference point.
Shelf Life
Shelf life is dependent on multiple factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms exhibit a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please communicate it to us, and we will prioritize its development.
Synonyms
Tspan17; Fbxo23; Tetraspanin-17; Tspan-17; F-box only protein 23
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Tspan17
Target Protein Sequence
MPGKHQQFQDPEVGCCGKYFLFGFNIVFWVLGALFLAIGLWAWGEKGVLSNISGLTDLGG LDPVWLFVVIGGIMSVLGFAGCIGALRENTFLLKFFSVFLGLIFFLELAAGILAFVFKDW IRDQLNLFINNNVKAYRDDIDLQNLIDFAQEYWSCCGARGPNDWNLNIYFNCTDLNPSRE RCGVPFSCCVRDPAEDVLNTQCGYDIRLKLELEQQGSIYTKGCVGQFEKWLQDNLIVVAG VLVAIALLQICGICLAQNLVSDIEAVKANW
Uniprot No.

Target Background

Function
Tetraspanin-17 (Tspan17) plays a regulatory role in the maturation of ADAM10.
Gene References Into Functions
  1. Immunohistochemical analyses revealed that the distribution of the receptor protein closely resembles the distribution of GHB high-affinity binding sites, except in the cerebellum. The labeling of the GHB receptor-like protein appears to be specifically localized in neurons. PMID: 16874802
  2. Findings suggest that ethanol does not influence [(3)H]NCS-382 binding in the rat brain, implying that ethanol does not directly interact with the GHB receptor. PMID: 18991884
Database Links

KEGG: rno:306771

UniGene: Rn.39086

Protein Families
Tetraspanin (TM4SF) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of Tetraspanin-17?

Tetraspanin-17 (Tspan17) is a member of the tetraspanin family of membrane proteins that contain four transmembrane domains. Like other tetraspanins, Tspan17 functions as a molecular scaffold that organizes proteins into highly structured microdomains consisting of adhesion, signaling, and adaptor proteins . Tspan17 belongs specifically to the TspanC8 subgroup (which includes Tspan5, 10, 14, 15, 17, and 33) and is primarily characterized by its ability to interact with the metalloprotease ADAM10 . This interaction facilitates ADAM10's exit from the endoplasmic reticulum, enzymatic maturation, and transport to the cell surface, ultimately affecting which substrate molecules ADAM10 cleaves .

How does rat Tspan17 differ from human Tspan17 in terms of structure and function?

While both rat and human Tspan17 maintain the characteristic four-transmembrane domain structure and belong to the TspanC8 subfamily, species-specific variations exist primarily in the extracellular domains and C-terminal regions. These differences may affect protein-protein interactions, though the core functionality in ADAM10 regulation appears conserved across species. When designing experiments with recombinant rat Tspan17, researchers should account for these species-specific differences, particularly when extrapolating findings to human systems or when studying interactions with species-specific binding partners.

What expression systems are most effective for producing recombinant rat Tspan17?

For recombinant rat Tspan17 production, mammalian expression systems (particularly HEK293 or CHO cells) typically yield the most functional protein with proper post-translational modifications. These systems better preserve the natural conformation of membrane proteins compared to bacterial systems. When using mammalian expression systems, researchers should optimize transfection conditions and consider stable cell line generation for consistent protein production. Expression vectors containing affinity tags (such as His6 or FLAG) positioned at either the N- or C-terminus facilitate subsequent purification, though care must be taken to ensure tags don't interfere with protein function.

What are the critical considerations for purifying functional recombinant rat Tspan17?

Purifying functional Tspan17 presents challenges typical of membrane proteins. Effective protocols typically employ mild detergents (DDM, CHAPS, or digitonin) for solubilization while maintaining protein integrity. A multi-step purification process combining affinity chromatography (using engineered tags) followed by size exclusion chromatography generally yields the purest preparations. When purifying Tspan17, researchers should verify protein folding through circular dichroism or limited proteolysis approaches and confirm functionality through binding assays with known interaction partners like ADAM10.

How does Tspan17 protect dopaminergic neurons from degeneration in experimental models?

Studies in C. elegans have demonstrated that TSP-17 (the C. elegans homolog of Tspan17) protects dopaminergic neurons from 6-OHDA-induced degeneration . The protective mechanism involves inhibition of the dopamine transporter DAT-1, which reduces 6-OHDA uptake into neurons . Additionally, TSP-17 interacts with the DOP-2 dopamine receptor, potentially as part of a pathway that negatively regulates DAT-1 . This protective function extends to shielding neurons from toxicity caused by excessive intracellular dopamine . Researchers studying rat Tspan17 in neurodegeneration contexts should consider designing experiments that evaluate its interaction with dopamine transporters and receptors, potentially offering insights into neuroprotective mechanisms relevant to Parkinson's disease models.

What techniques are most effective for studying Tspan17 function in neuronal cells?

When investigating Tspan17 in neuronal contexts, researchers should consider multiple complementary approaches. Primary neuronal cultures expressing fluorescently-tagged Tspan17 enable visualization of subcellular localization via confocal microscopy. For functional studies, CRISPR-Cas9 gene editing or RNA interference approaches in primary neurons or neuron-like cell lines help establish causality. Electrophysiological recordings combined with Tspan17 manipulation can reveal effects on neuronal activity, while co-immunoprecipitation experiments identify neuronal interaction partners. In vivo models using conditional knockout approaches provide system-level insights into Tspan17's neurological functions.

How does Tspan17 expression affect glioblastoma progression and what are the implications for using it as a research target?

Research has revealed that high TSPAN17 expression levels are associated with poor prognosis in glioblastoma multiforme (GBM) patients . Specifically, elevated TSPAN17 correlates with larger tumor sizes (≥5 cm), advanced WHO stage, and poorer outcomes in patients aged 50-60 . Mechanistically, TSPAN17 appears to promote GBM cell proliferation, migration, and invasion while inhibiting apoptosis . The microRNA miR-378a-3p directly targets TSPAN17, and overexpression of miR-378a-3p decreases TSPAN17 expression, leading to reduced proliferation, migration, and invasion of GBM cells . These findings suggest that Tspan17 may function as an oncogene in GBM and could represent a potential therapeutic target. Researchers studying Tspan17 in cancer contexts should consider designing experiments that evaluate the downstream signaling pathways activated by Tspan17 and their contributions to oncogenic processes.

What methodological approaches are recommended for studying Tspan17's role in cancer cell migration and invasion?

For investigating Tspan17's effects on cancer cell migration and invasion, researchers should employ multiple complementary assays. Wound healing (scratch) assays provide qualitative insights into migration rates of cells with modulated Tspan17 expression. Transwell migration assays offer quantitative measurements of directed migration, while Matrigel-coated transwell chambers assess invasive capacity. Real-time cell analysis systems enable continuous monitoring of migration dynamics. These functional assays should be complemented by molecular analyses exploring the effect of Tspan17 on relevant signaling pathways (e.g., ADAM10-mediated shedding of proteins involved in cell adhesion and migration). Researchers might also consider 3D spheroid invasion models for more physiologically relevant assessments of invasive behavior.

How can researchers effectively study the interaction between Tspan17 and ADAM10?

To investigate the Tspan17-ADAM10 interaction, researchers can employ multiple complementary approaches. Co-immunoprecipitation using antibodies against either protein can confirm their association in cellular contexts. Proximity ligation assays visually demonstrate the interaction in situ with subcellular resolution. For more detailed interaction mapping, researchers might use the split-ubiquitin membrane-based yeast two-hybrid system, which has proven effective for studying membrane protein interactions . FRET or BRET approaches using fluorescently-tagged proteins can provide insights into the dynamics of this interaction in living cells. Functional assays measuring ADAM10 enzymatic activity (using fluorogenic substrates) in the presence or absence of Tspan17 can determine how this interaction affects ADAM10 function. Additionally, surface plasmon resonance or microscale thermophoresis with purified proteins can determine binding kinetics and affinity.

What is known about the interaction between Tspan17 and dopamine receptors, and how can this be further investigated?

Studies in C. elegans have shown that TSP-17 (Tspan17 homolog) interacts with the DOP-2 dopamine receptor . Using the split-ubiquitin membrane-based yeast two-hybrid system, researchers demonstrated a direct physical interaction between TSP-17 and DOP-2 . This interaction might modulate receptor activity by affecting ligand binding, downstream signaling, or membrane trafficking . To further investigate this interaction in the rat system, researchers could employ co-immunoprecipitation studies using rat brain tissue or transfected cell systems, followed by proteomics analysis to identify additional components of the complex. Mapping the interaction domains through mutagenesis studies would provide structural insights. Functional assays measuring dopamine receptor signaling (e.g., cAMP levels, calcium imaging, or β-arrestin recruitment) in cells with modulated Tspan17 expression would reveal the functional consequences of this interaction.

What methods are recommended for accurately quantifying Tspan17 expression in tissue samples?

For accurate quantification of Tspan17 expression, researchers should employ multiple complementary approaches. RT-qPCR using validated primers specific to rat Tspan17 can quantify mRNA levels, though reference gene selection should be carefully validated for the specific tissue context. Western blotting with validated antibodies provides protein-level quantification, but membrane protein extraction protocols must be optimized to ensure complete solubilization. Immunohistochemistry or immunofluorescence enables spatial analysis of expression patterns within tissues but requires careful antibody validation. For higher throughput analysis across multiple samples, droplet digital PCR offers absolute quantification without requiring standard curves. Researchers should be aware that Tspan17 expression may vary significantly across different cell types within heterogeneous tissues, potentially necessitating cell isolation techniques prior to analysis.

How do genetic variations in Tspan17 affect its function, and what are the implications for neurological and oncological research?

Genetic variations in TSPAN17 have been linked to several conditions, including a de novo nonsense variant identified in an autism spectrum disorder proband . In cancer research, variations affecting TSPAN17 expression levels appear important, as high expression correlates with poor prognosis in glioblastoma . These findings suggest that both loss-of-function and gain-of-function Tspan17 variants may have pathological consequences. When designing experiments, researchers should consider generating equivalent mutations in rat Tspan17 to study their functional effects. Key approaches include using CRISPR-Cas9 to introduce specific mutations, overexpression studies to model increased Tspan17 activity, and rescue experiments in Tspan17-knockout backgrounds. Analyzing how these variations affect interactions with partners like ADAM10 and dopamine receptors provides mechanistic insights, while assessing downstream cellular phenotypes reveals functional consequences.

How can recombinant rat Tspan17 be utilized to develop neuroprotective strategies for Parkinson's disease models?

Based on the finding that TSP-17 protects dopaminergic neurons from 6-OHDA-induced degeneration in C. elegans , researchers can explore similar neuroprotective mechanisms in rat models of Parkinson's disease. Approaches might include developing recombinant Tspan17 peptides that mimic the protein's neuroprotective domains or identifying small molecules that enhance Tspan17's interaction with dopamine transporters and receptors. Targeted delivery of Tspan17-expressing viral vectors to the substantia nigra in rat PD models could evaluate whether enhanced Tspan17 expression confers neuroprotection. Additionally, researchers might investigate whether Tspan17's protective effects extend to other neurotoxin-based PD models (e.g., MPTP, rotenone) or α-synuclein-based models. The dopamine transporter inhibition mechanism observed in C. elegans should be specifically examined in rat dopaminergic neurons to determine conservation of this neuroprotective pathway.

What are the methodological challenges in studying the roles of Tspan17 in forming tetraspanin-enriched microdomains (TEMs), and how can these be addressed?

Studying Tspan17's role in tetraspanin-enriched microdomains (TEMs) presents significant technical challenges due to their small size, dynamic nature, and complex composition. Advanced imaging approaches such as super-resolution microscopy (STORM, PALM) or STED can overcome diffraction limits to visualize TEM organization. Detergent fractionation experiments using varying stringencies can biochemically characterize TEM composition, while proximity labeling approaches (BioID, APEX) can identify proteins within the microenvironment of Tspan17. Lipidomic analysis of Tspan17-containing membrane fractions helps characterize the lipid composition of associated TEMs. Single-molecule tracking provides insights into Tspan17 dynamics within TEMs, and FRET-based approaches can measure protein interactions within these domains. Researchers should also develop selective TEM disruption strategies to determine how these domains contribute to Tspan17's functions in specific cellular processes.

How conserved is Tspan17 function across species, and what are the implications for translational research?

Tspan17 functions appear conserved across species, with the C. elegans homolog (TSP-17) demonstrating roles in dopaminergic neuron protection similar to those proposed in mammalian systems . The TspanC8 subfamily, including Tspan17, consistently interacts with ADAM10 across species, suggesting evolutionary conservation of this functional relationship . When designing experiments with rat Tspan17, researchers should consider this evolutionary context, potentially using cross-species complementation studies to determine functional conservation. Particular attention should be paid to species-specific interaction partners that might modify Tspan17 function in different organisms. Phylogenetic analysis of Tspan17 sequence conservation, particularly in functional domains, can guide the design of targeted mutations for structure-function studies.

What can we learn from comparing Tspan17 with other members of the tetraspanin family in terms of functional specificity?

Comparative analysis of Tspan17 with other tetraspanins, particularly within the TspanC8 subfamily (Tspan5, 10, 14, 15, 17, and 33), reveals both shared and unique functions . While all TspanC8 members interact with ADAM10, they appear to direct this metalloprotease toward different substrates, suggesting functional specialization . Tspan17's specific roles in dopaminergic signaling and potential oncogenic functions in glioblastoma distinguish it from other family members. To leverage these comparative insights, researchers should design experiments that systematically compare Tspan17 with other tetraspanins in the same experimental systems. This might include domain-swapping experiments to identify regions responsible for functional specificity, side-by-side comparison of interaction partners through proteomics approaches, or parallel phenotypic analysis following manipulation of different tetraspanins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.