Recombinant Rat Tetraspanin-1 (Tspan1)

Shipped with Ice Packs
In Stock

Description

Introduction to Tetraspanin-1 (Tspan1)

Tetraspanin-1 (Tspan1) is a member of the transmembrane 4 superfamily (tetraspanins), characterized by four hydrophobic domains that mediate signal transduction critical for cell development, motility, and differentiation . In rats (Rattus norvegicus), Tspan1 (gene ID: 298436) shares structural and functional homology with human and mouse orthologs, playing roles in neuronal differentiation, cancer progression, and receptor trafficking . Recombinant Rat Tspan1 is a laboratory-engineered protein used to study these biological processes in controlled settings.

Recombinant Rat Tspan1: Production and Characteristics

Recombinant Rat Tspan1 is typically produced via prokaryotic expression systems, such as Escherichia coli, to ensure high yield and purity. While direct data on rat-specific production is limited, insights can be extrapolated from homologous human Tspan1 protocols :

PropertyDetails
Expression HostEscherichia coli (prokaryotic system)
Residues ExpressedPartial sequences (e.g., Thr112–Val215 in human homolog)
TagsN-terminal His tag for purification
Purity>95% (verified by SDS-PAGE)
Molecular Weight~15–16 kDa (predicted based on human homolog)
Buffer FormulationPBS (pH 7.4) with 0.01% SKL stabilizer and 5% trehalose
Storage-80°C for long-term; avoid repeated freeze-thaw cycles

This recombinant protein is used for applications such as immunogen development, antibody production, and functional studies .

Functional Roles in Rat Models

  • Neuronal Differentiation: Tspan1 stabilizes TrkA receptors in the endoplasmic reticulum (ER), promoting surface expression and NGF-mediated axonal growth in dorsal root ganglion (DRG) neurons .

  • Proteostasis Regulation: Knockdown of Tspan1 redirects TrkA to autophagy/lysosomal degradation, impairing neuronal signaling .

  • Cancer Relevance: While direct rat cancer data is limited, human studies show Tspan1 promotes tumor growth via PI3K/Akt and Wnt/β-catenin pathways .

Table 1: Key Research Findings Involving Tspan1

Study FocusFindingsSource
TrkA TraffickingTspan1 binds immature TrkA in the ER, preventing aggregation and degradation .
Pancreatic CancersiRNA-mediated Tspan1 knockdown reduces proliferation and invasion in vitro .
Breast CancerTspan1 silencing inhibits EMT and PI3K/Akt signaling, suppressing metastasis .
Therapeutic TargetingTspan1-linked nanobubbles in HCC models reduce tumor growth and improve survival .

Experimental Use of Recombinant Tspan1

  • Antibody Validation: Recombinant Tspan1 serves as a positive control in Western blotting and immunohistochemistry .

  • Mechanistic Studies: Used to elucidate Tspan1’s role in receptor chaperoning and cancer signaling pathways .

Future Directions

  1. Structural Studies: High-resolution crystallography of rat Tspan1 to map interaction sites with TrkA and integrins.

  2. Therapeutic Development: Explore Tspan1-targeted siRNA or monoclonal antibodies for neurodegenerative diseases and cancers.

  3. Cross-Species Comparisons: Validate functional conservation between rat and human Tspan1 in disease models.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its use.
Synonyms
Tspan1; Tetraspanin-1; Tspan-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-241
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Tspan1
Target Protein Sequence
MQCFKFIKVMMILFNLLIFLCGAALLAVGIWVSVDGTSFLKAFGSLSSSAMQFVNVGYFL IAAGAVLFILGFLGCYGAHSENKCVLMMFFSILLIIFIAEIAGAVVALVYTTMAEQFLTF LVVPAIEKDYGYQTEFTQVWNSTMEGLHCCGFNNYTDFNSSRFVKENKVFPPFCCANNTD SHTVEPCTEDKAKSMNVQGCFKQILQKIRTNAVTVGGVAVGVAALELAAMVVSMYLYCNL K
Uniprot No.

Target Background

Database Links

KEGG: rno:298436

UniGene: Rn.33830

Protein Families
Tetraspanin (TM4SF) family
Subcellular Location
Lysosome membrane; Multi-pass membrane protein.

Q&A

What is Tetraspanin-1 and where is it expressed in rat tissues?

Tetraspanin-1 (Tspan1) is a member of the transmembrane 4 superfamily, characterized by four hydrophobic domains that span the cell membrane. It mediates signal transduction events that regulate cell development, activation, growth, and motility . In rats, Tspan1 is notably expressed in developing dorsal root ganglion (DRG) neurons, with expression increasing between embryonic days E15.5 and E17.5, corresponding to the period when these neurons receive target-derived nerve growth factor (NGF) . Immunofluorescence studies have demonstrated that approximately 40-50% of TrkA-positive DRG neurons express Tspan1, while more than 80% of Tspan1-positive cells also express TrkA, suggesting a significant functional relationship between these proteins .

What cellular functions does Tspan1 regulate in rats?

Tspan1 serves as a critical regulator of NGF signaling and neuronal differentiation. Research has demonstrated that downregulation of Tspan1 in sensory neurons inhibits NGF-mediated axonal growth . At the molecular level, Tspan1 forms a complex with the immature form of TrkA receptor in the endoplasmic reticulum (ER), influencing its biosynthetic trafficking and degradation . Beyond neuronal functions, Tspan1, like other tetraspanins, participates in tetraspanin-enriched microdomains (TEMs) that regulate fundamental biological processes including cell proliferation, adhesion, and migration .

What techniques are most effective for detecting Tspan1 expression in rat tissues?

Multiple complementary approaches are recommended for comprehensive Tspan1 detection:

  • Quantitative RT-PCR: For measuring Tspan1 mRNA expression in tissues and cell lines. Primers specific for rat Tspan1 (such as forward 5′-TGGGCTGCTATGGTGCTA-3′ and reverse 5′-GCAGGTTTCATTGGCTGT-3′) can be used with GAPDH as a reference gene .

  • Western Blot Analysis: For protein-level detection, using specific anti-Tspan1 antibodies. This technique distinguishes between different molecular weight forms of the protein.

  • Immunofluorescence/Immunohistochemistry: For visualizing cellular localization patterns. In DRG neurons, double immunostaining with anti-TrkA antibodies can reveal co-expression patterns .

  • Co-immunoprecipitation: For detecting protein-protein interactions, as demonstrated in studies showing Tspan1 interactions with immature TrkA and the chaperone calnexin (CNX) .

How can recombinant Rat Tspan1 be produced for research applications?

Production of functional recombinant Tspan1 requires careful consideration of its transmembrane nature:

  • Expression System Selection: Mammalian expression systems (such as HEK293 or CHO cells) are preferred over bacterial systems to ensure proper post-translational modifications and folding.

  • Vector Design: Incorporation of epitope tags (e.g., myc-tag) facilitates detection and purification while minimizing interference with protein function .

  • Purification Strategy: Due to its hydrophobic domains, detergent-based extraction methods optimized for membrane proteins are necessary.

  • Quality Control: Validation through mass spectrometry, circular dichroism for secondary structure, and functional assays to ensure the recombinant protein maintains native properties.

How does Tspan1 regulate TrkA receptor trafficking in rat neurons?

Tspan1 plays a crucial homeostatic role in coordinating TrkA receptor biosynthetic trafficking and degradation. Research has revealed that:

  • Tspan1 specifically interacts with the immature form of TrkA (110 kDa) localized in the endoplasmic reticulum but not with the mature, cell surface form (140 kDa) .

  • This interaction occurs in a complex that includes the lectin chaperone calnexin (CNX), suggesting Tspan1 involvement in early TrkA biosynthetic processing .

  • Knockdown of Tspan1 reduces surface levels of TrkA by promoting its preferential sorting towards autophagy/lysosomal degradation pathways, regardless of NGF presence .

These findings establish Tspan1 as a critical regulator of neurotrophin receptor availability at the cell surface, ultimately affecting NGF-mediated signaling and neuronal differentiation.

What experimental approaches can test the functional relationship between Tspan1 and TrkA in neuronal development?

Several methodological approaches can be employed:

  • RNA Interference: Using shRNA or siRNA to downregulate Tspan1 in neuronal cultures, followed by assessment of TrkA surface expression, NGF signaling (phosphorylation of downstream effectors), and neurite outgrowth .

  • Co-immunoprecipitation Assays: To detect physical interactions between Tspan1 and TrkA in both recombinant systems and native tissues .

  • Subcellular Fractionation: To determine the compartment-specific distribution of Tspan1 and TrkA complexes.

  • Pulse-Chase Experiments: To track the biosynthetic progression of TrkA with and without Tspan1 manipulation.

  • Live Cell Imaging: Using fluorescently tagged proteins to monitor trafficking dynamics in real-time.

What is known about Tspan1's role in disease models and potential therapeutic implications?

Tspan1 has been implicated in multiple pathological processes:

  • Cancer Progression: Elevated Tspan1 expression has been documented in several cancer types including pancreatic cancer, breast cancer, and cholangiocarcinoma . In pancreatic cancer cells, siRNA-mediated knockdown of Tspan1 significantly reduced proliferation, increased apoptosis, and inhibited migration and invasion capabilities .

  • Metastasis: Tspan1 immunopositive staining significantly correlates with lymph node metastasis, advanced tumor stages, and poor prognosis in pancreatic cancer patients .

  • Angiogenesis: Downregulation of Tspan1 in breast cancer cells inhibits endothelial tube formation, suggesting a role in tumor angiogenesis .

These findings suggest that Tspan1-targeting strategies could have therapeutic potential in certain cancers, though the role of Tspan1 in rat disease models needs further investigation.

How do the functions of rat Tspan1 compare with human TSPAN1 in experimental models?

While both rat and human Tspan1 share significant sequence homology and functional similarities, species-specific differences may exist. Research comparing the two suggests:

  • Both human and rat Tspan1 interact with immature forms of TrkA receptors in the endoplasmic reticulum .

  • Conserved roles in cell proliferation, migration, and invasion have been observed across species .

  • The developmental expression patterns of Tspan1 in neural tissues appear consistent between species, with upregulation during periods of active neuronal growth and target innervation .

When designing experiments using recombinant rat Tspan1 with the intention of translating findings to human contexts, researchers should consider these similarities while acknowledging potential species-specific differences in binding partners or signaling pathways.

What are the most effective knockdown approaches for studying Tspan1 function in rat models?

Several approaches have proven effective for Tspan1 knockdown:

RNA Interference Strategies:

ApproachAdvantagesLimitationsExperimental Considerations
siRNARapid effect, high transfection efficiencyTransient effect (3-5 days)Optimal for short-term studies in cultured neurons or cell lines
shRNA via lentiviral vectorsStable long-term knockdown, applicable to in vivo modelsMore complex delivery systemEssential for developmental studies or long-term analyses
CRISPR/Cas9Complete gene knockout possiblePotential off-target effectsUseful for creating stable Tspan1-null cell lines

For rat DRG neurons specifically, lentiviral delivery of shRNA has been effectively used to demonstrate the role of Tspan1 in NGF-mediated axonal growth . When designing knockdown experiments, including appropriate controls (scrambled sequences) and validating knockdown efficiency at both mRNA and protein levels are essential steps.

How can protein-protein interactions of Tspan1 be comprehensively mapped in rat neural tissues?

Mapping the Tspan1 interactome requires multiple complementary approaches:

  • Proximity Labeling Methods: BioID or APEX2 fused to Tspan1 to identify proteins in close proximity within living cells.

  • Co-immunoprecipitation Combined with Mass Spectrometry: Using antibodies against Tspan1 to pull down interacting proteins from rat neural tissue lysates, followed by mass spectrometric identification .

  • Yeast Two-Hybrid Screening: Although challenging for transmembrane proteins, modified membrane yeast two-hybrid systems can be employed.

  • Crosslinking Mass Spectrometry: Chemical crosslinking followed by mass spectrometry to capture transient interactions.

  • Super-Resolution Microscopy: Techniques such as STORM or PALM can visualize co-localization of Tspan1 with potential partners at nanoscale resolution.

Research has already established interactions between Tspan1 and immature TrkA, as well as with calnexin in the endoplasmic reticulum . Further interactome mapping could reveal additional partners involved in trafficking, signaling, or degradation pathways.

How conserved is Tspan1 across species and what implications does this have for using rat models?

Tspan1 demonstrates notable evolutionary conservation across multiple species:

SpeciesGene IDConservation LevelNotable Features
Human10103ReferenceTransmembrane 4 superfamily member
Rat298436High homology to humanWell-characterized in DRG development
Mouse66805High homology to ratSimilar expression patterns to rat
Dog475370ConservedFunctional similarities presumed
Cow506550ConservedFunctional similarities presumed
Chicken424607Moderate conservationIndicates evolutionary importance

What are the promising areas for future research on rat Tspan1?

Several research directions hold particular promise:

  • Comprehensive Interactome Mapping: Beyond TrkA and calnexin, identifying the full range of Tspan1 binding partners in different cellular compartments and developmental stages.

  • In Vivo Functional Studies: Developing conditional knockout models to assess Tspan1's role in specific tissues during development and in disease states.

  • Structural Studies: Determining the three-dimensional structure of Tspan1, particularly its interaction domains with TrkA and other partners.

  • Therapeutic Targeting Strategies: Given its role in cancer progression, exploring small molecules, peptides, or antibodies that could modulate Tspan1 function .

  • Comparative Studies: Systematic comparison of rat and human Tspan1 functions to better translate findings between species.

As research continues to elucidate the multifaceted roles of Tspan1 in development, signaling, and disease, these approaches will likely yield valuable insights with potential translational applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.