Recombinant Rat Tetraspanin-5 (Tspan5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we strive to ship the format we have in stock, we understand you may have specific requirements. Please indicate your preferred format in the order notes and we will accommodate your request to the best of our ability.
Lead Time
Delivery times may vary based on your location and purchasing method. For precise delivery estimates, please contact your local distributor.
Note: Our standard shipping includes blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles should be avoided. Store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize its development.
Synonyms
Tspan5; Tm4sf9; Tetraspanin-5; Tspan-5; Transmembrane 4 superfamily member 9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-268
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Tspan5
Target Protein Sequence
MSGKHYKGPEVSCCIKYFIFGFNVIFWFLGITFLGIGLWAWNEKGVLSNISSITDLGGFD PVWLFLVVGGVMFILGFAGCIGALRENTFLLKFFSVFLGIIFFLELTAGVLAFVFKDWIK DQLYFFINNNIRAYRDDIDLQNLIDFTQEYWQCCGAFGADDWNLNIYFNCTDSNASRERC GVPFSCCTKDPAEDVINTQCGYDARQKPEVDQQIVIYTKGCVPQFEKWLQDNLTIVAGIF IGIALLQIFGICLAQNLVSDIEAVRASW
Uniprot No.

Target Background

Function
Tetraspanin-5 (Tspan5) plays a regulatory role in ADAM10 maturation and trafficking to the cell surface. It facilitates ADAM10-mediated cleavage of CD44.
Database Links

KEGG: rno:362048

UniGene: Rn.98240

Protein Families
Tetraspanin (TM4SF) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Tetraspanin-5 (Tspan5) and what is its function in neurons?

Tetraspanin-5 (Tspan5) is a member of the tetraspanin family, which consists of 33 mammalian proteins . It belongs specifically to the C8 subgroup of tetraspanins and plays crucial roles in neuronal function. In rat hippocampal neurons, Tspan5 regulates the exocytosis of AMPA receptors (AMPARs) by interacting with the adaptor protein complex AP4 and Stargazin . Tspan5 promotes the delivery of AMPARs to the cell surface without affecting their internalization, thus modulating excitatory synaptic transmission . Additionally, Tspan5 is enriched in dendritic spines and has been shown to promote their morphological maturation during synaptogenesis .

How is Tspan5 structurally organized in cellular membranes?

Tspan5, like other tetraspanins, contains four transmembrane domains with intracellular N- and C-terminal tails. The C-terminal tail is particularly significant as it mediates protein-protein interactions. Research has demonstrated that this region interacts directly with the AP4σ subunit of the adaptor protein complex AP4 . Tspan5 exists in both surface and intracellular pools in neurons, with the intracellular pool increasing during neuronal maturation (from DIV12 to DIV19) . The protein appears as a complex pattern of bands in western blot analysis due to its association with cholesterol-rich membranes, making it poorly soluble in standard lysis buffers . Functionally, Tspan5 participates in the formation of tetraspanin-enriched microdomains (TEMs), which serve as organizational platforms for various cellular processes .

How does Tspan5 differ from other tetraspanin family members in the brain?

While multiple tetraspanins are expressed in the brain, Tspan5 shows specific functional characteristics that distinguish it from other family members. Notably, Tspan5 demonstrates specificity in its interactions - when researchers performed GST pulldown experiments using the C-terminal tail of Stargazin, they detected Tspan5 but not CD81 (another tetraspanin family member) in the precipitate . Furthermore, Tspan5 appears to have a selective role in AMPAR trafficking and spine morphogenesis that is not shared by all tetraspanins. Previous studies have shown that different tetraspanins in neurons can regulate various aspects of neurotransmitter receptor trafficking, suggesting functional specialization within this protein family .

How does Tspan5 expression change during neuronal development?

Analysis of Tspan5 expression during neuronal development reveals interesting dynamics. Using BS3 crosslinking experiments, which distinguish between surface and intracellular protein pools, researchers observed that the intracellular levels of Tspan5 significantly increase from DIV12 (when synaptogenesis is prominent) to DIV19 (when neurons are considered functionally mature) . Interestingly, this increase in intracellular Tspan5 is not accompanied by a proportional increase in plasma membrane levels, suggesting that the intracellular pool serves specific functions beyond simply supplying the surface pool . This developmental regulation hints at the importance of intracellular Tspan5 in mature neuronal function, potentially related to ongoing AMPAR trafficking required for synaptic plasticity.

What methods are most effective for visualizing Tspan5 in neurons?

Visualizing Tspan5 in neurons requires specific approaches due to its distribution across multiple cellular compartments. Successful studies have employed:

  • Immunofluorescence with specific antibodies: This approach allows detection of endogenous Tspan5, though careful validation of antibody specificity is essential.

  • Tagged recombinant Tspan5: Expression of GFP-tagged Tspan5 enables live imaging studies and has been successfully used to assess its localization .

  • BS3 crosslinking followed by western blotting: This technique distinguishes between surface and intracellular pools of Tspan5 .

  • Proximity Ligation Assay (PLA): This approach has been used to detect the association between Tspan5 and other proteins such as GluA2 in specific subcellular compartments .

  • Colocalization with compartment markers: Cotransfection with fluorescently tagged markers like Rab4-GFP, Rab7-GFP, or Rab11-GFP helps determine the precise subcellular localization of Tspan5 .

What proteins does Tspan5 interact with in neurons?

Tspan5 engages in multiple protein-protein interactions that mediate its functions in neurons. Key interaction partners include:

ProteinInteraction EvidenceFunctional Significance
AP4 complex (AP4σ, AP4ε)Yeast two-hybrid, GST pulldown, co-immunoprecipitation Mediates AMPAR trafficking
StargazinGST pulldown Links Tspan5 to AMPAR regulation
GluA1GST pulldown AMPAR subunit trafficking
GluA2/3GST pulldown (more efficient than GluA1) Preferential association with GluA2/3-containing AMPARs
Neuroligin-1Previously reported Controls surface mobility of this postsynaptic adhesion molecule
ADAM-10Previously reported Regulates intracellular trafficking and activity of this protease

Notably, Tspan5 does not interact with the NMDA receptor subunit GluN2A, supporting the specificity of its interactions with AMPARs .

How does the C-terminal domain of Tspan5 mediate protein interactions?

The C-terminal domain of Tspan5 plays a critical role in mediating protein interactions. Research using yeast two-hybrid screening with the C-terminal tail of Tspan5 as bait identified AP4σ (amino acids 1-102) as an interaction partner . This interaction was validated using GST pulldown experiments with the C-terminus of Tspan5 fused to GST (GST-Ct), which successfully precipitated AP4ε from rat brain lysates . The functional importance of this domain was demonstrated using a Tspan5 construct lacking the C-terminal domain (TSPAN5-ΔC), which failed to rescue the effects of Tspan5 knockdown on surface GluA2 levels . This confirms that the C-terminal domain is essential for Tspan5's role in AMPAR trafficking, likely through its interaction with the AP4 complex.

What experimental approaches are most effective for studying Tspan5 protein interactions?

Multiple experimental approaches have proven effective for investigating Tspan5 protein interactions:

  • Yeast two-hybrid screening: This approach successfully identified the interaction between Tspan5's C-terminal domain and AP4σ .

  • GST pulldown assays: Using the C-terminal tail of Tspan5 fused to GST allows for identification of binding partners from brain lysates .

  • Co-immunoprecipitation: This technique confirmed interactions between endogenous Tspan5, AP4σ, and AP4ε in rat brain lysates .

  • Heterologous expression systems: The formation of the Tspan5-AP4-Stargazin-GluA2 complex has been confirmed in HeLa cells transfected with TSPAN5-GFP, Stargazin-HA, and GluA2 .

  • Proximity Ligation Assay (PLA): This method allows for detection of protein-protein interactions in situ with specific subcellular resolution .

  • Sucrose gradient fractionation: This approach helps identify the subcellular compartments where protein complexes containing Tspan5 reside .

How does Tspan5 regulate AMPA receptor surface expression?

Tspan5 plays a specific role in regulating AMPA receptor surface expression through exocytosis without affecting receptor internalization . The mechanism involves several key components:

  • Interaction with AP4 and Stargazin: Tspan5 forms a complex with the adaptor protein complex AP4 and the AMPAR auxiliary subunit Stargazin, which connects Tspan5 to AMPARs .

  • Recycling endosome pathway: Tspan5 colocalizes extensively with Rab11-positive recycling endosomes, suggesting that it facilitates AMPAR exocytosis through this pathway .

  • Differential regulation of AMPAR subunits: Knockdown of Tspan5 in rat hippocampal neurons reduces surface levels of GluA2 but increases surface GluA1, suggesting subunit-specific regulation .

  • C-terminal domain dependency: The C-terminal domain of Tspan5 is essential for this function, as a Tspan5 construct lacking this domain fails to rescue the effects of Tspan5 knockdown .

The importance of this regulatory mechanism is highlighted by the fact that knockdown of AP4β and AP4ε using CRISPR/Cas9 affects AMPAR surface expression in a manner consistent with Tspan5's role .

Does Tspan5 affect different AMPA receptor subunits differently?

Yes, Tspan5 exhibits differential effects on AMPA receptor subunits. When Tspan5 was knocked down in rat hippocampal neurons (DIV12-20), researchers observed:

  • Decreased surface GluA2: Knockdown of Tspan5 reduced surface GluA2 levels, an effect that was reversed by re-expression of wild-type Tspan5 .

  • Increased surface GluA1: In contrast, Tspan5 knockdown increased surface GluA1 levels, which was also reversed by the rescue construct .

  • Preferential association with GluA2/3: GST pulldown experiments showed that the C-terminal tail of Tspan5 more efficiently pulled down GluA2/3 than GluA1, suggesting a preferential association with GluA2/3-containing AMPARs .

These findings suggest that Tspan5 may play a role in regulating the subunit composition of surface AMPARs, potentially influencing their functional properties such as calcium permeability and channel conductance.

What trafficking routes does Tspan5 use for AMPA receptor delivery?

Evidence suggests that Tspan5 utilizes recycling endosomes as the primary trafficking route for AMPA receptor delivery to the plasma membrane:

  • Colocalization studies: Tspan5 shows high colocalization with Rab11-positive recycling endosomes (Mander's M1 coefficient: 0.94±0.02), significantly higher than with Rab4-positive early endosomes (0.77±0.02) or Rab7-positive late endosomes (0.79±0.06) .

  • Proximity Ligation Assay (PLA): PLA signals between Tspan5 and GluA2 were detected in Rab5-, Rab7-, and Rab11-positive compartments, but were particularly prominent in Rab11-positive recycling endosomes .

  • Biochemical fractionation: In sucrose gradient fractionation of synaptosomes, Tspan5, AP4ε, Stargazin, GluA1, and GluA2/3 were all found in heavier fractions positive for the recycling endosome marker transferrin receptor .

This trafficking route appears to be specifically involved in the exocytosis of AMPARs, as Tspan5 was found to promote receptor exocytosis without affecting internalization .

What are effective methods for manipulating Tspan5 expression in neurons?

Researchers have successfully employed several approaches to manipulate Tspan5 expression in neurons:

  • RNA interference (RNAi): Knockdown of Tspan5 using shRNA delivered via transfection has proven effective in cultured rat hippocampal neurons .

  • Rescue experiments: Co-expression of shRNA-resistant Tspan5 constructs allows for confirmation of specificity and functional studies of mutant Tspan5 proteins. For example, researchers used a Tspan5 construct lacking the C-terminal domain (TSPAN5-ΔC) to demonstrate the importance of this region .

  • CRISPR/Cas9: While not directly used for Tspan5 in the provided studies, this approach was successfully employed to knock down AP4β and AP4ε in rat hippocampal neurons, suggesting it could be adapted for Tspan5 .

  • Lentiviral delivery: Lentiviral particles coding for shRNA or CRISPR components provide efficient delivery to neurons and allow for longer-term experiments .

For optimal results, transfection or transduction is typically performed at DIV12 in rat hippocampal neurons, with analysis at DIV19-20 when neurons are functionally mature .

How can researchers quantify Tspan5-mediated effects on AMPA receptor trafficking?

Several quantitative methods have been established to assess Tspan5's effects on AMPAR trafficking:

  • Surface biotinylation: This biochemical approach allows for quantification of total surface receptor levels.

  • Surface immunolabeling: Immunocytochemistry with antibodies recognizing extracellular epitopes of AMPAR subunits (without permeabilization) enables visualization and quantification of surface receptors .

  • BS3 crosslinking: This technique distinguishes between surface (crosslinked, high molecular weight) and intracellular (non-crosslinked, normal molecular weight) protein pools in western blot analysis .

  • Compartment-specific analysis: By restricting quantification to specific subcellular compartments (e.g., dendritic spines versus dendritic shafts), researchers can gain insight into the spatial specificity of Tspan5's effects .

  • Live imaging with pH-sensitive GFP variants: Super-ecliptic pHluorin (SEP) tagged AMPARs can be used to specifically visualize surface receptors and monitor exocytosis events in real-time.

What technical challenges should researchers anticipate when studying Tspan5?

Researchers studying Tspan5 should be prepared for several technical challenges:

  • Complex banding pattern: Tspan5 appears as a complex pattern of bands in western blot analysis due to its association with cholesterol-rich membranes, making quantification challenging .

  • Antibody specificity: As with many membrane proteins, generating specific antibodies can be difficult. Careful validation of antibody specificity is essential, particularly when studying endogenous protein.

  • Functional redundancy: Other tetraspanins might compensate for Tspan5 loss, potentially masking phenotypes in knockdown experiments.

  • Protein complex integrity: Harsh detergents can disrupt tetraspanin-enriched microdomains (TEMs), so careful consideration of lysis conditions is necessary for interaction studies .

  • Temporal dynamics: Given the developmental regulation of Tspan5, the timing of experiments is critical. Most published studies use neurons at DIV19-20 for final analyses .

How might Tspan5 contribute to synaptic plasticity mechanisms?

Given Tspan5's role in AMPAR trafficking, it likely contributes to synaptic plasticity mechanisms:

  • Subunit-specific regulation: Tspan5's differential effects on GluA1 versus GluA2 surface expression could influence the subunit composition of synaptic AMPARs during plasticity events. GluA2-lacking AMPARs are calcium-permeable and associated with specific forms of plasticity.

  • Activity-dependent trafficking: The intracellular pool of Tspan5 increases during neuronal maturation , suggesting potential activity-dependent regulation that could be important for homeostatic or Hebbian plasticity.

  • Interaction with Stargazin: Tspan5's association with Stargazin , which undergoes phosphorylation during synaptic plasticity, suggests it may be part of the molecular machinery that responds to plasticity-inducing signals.

  • Recycling endosome pathway: The recycling endosome pathway utilized by Tspan5 is critical for AMPAR insertion during long-term potentiation (LTP).

Future research should investigate whether neuronal activity regulates Tspan5 expression, localization, or interactions, and whether Tspan5 is required for specific forms of synaptic plasticity.

What are the methodological approaches for investigating Tspan5 function in vivo?

Advanced investigation of Tspan5 function in vivo could employ several methodological approaches:

  • Conditional knockout models: Generation of floxed Tspan5 alleles combined with cell-type specific Cre expression would allow for targeted deletion in specific neuronal populations.

  • Viral-mediated manipulation: Stereotaxic injection of AAVs expressing shRNA or CRISPR/Cas9 components targeting Tspan5 could achieve region-specific knockdown in adult animals.

  • Knock-in models: Introduction of tagged Tspan5 or specific mutations (e.g., C-terminal truncation) would allow for visualization of endogenous protein and functional studies.

  • Behavioral testing: Assessment of learning, memory, and other cognitive functions in animals with altered Tspan5 expression could reveal its significance for higher brain functions.

  • Electrophysiology: Patch-clamp recordings in brain slices from animals with altered Tspan5 expression would allow for functional assessment of synaptic transmission and plasticity.

  • In vivo imaging: Two-photon microscopy of fluorescently labeled Tspan5 in combination with labeled AMPARs could provide insights into trafficking dynamics in the intact brain.

How does Tspan5 function within tetraspanin-enriched microdomains (TEMs)?

Tetraspanins form specialized membrane domains called tetraspanin-enriched microdomains (TEMs) , and understanding Tspan5's function within these structures represents an advanced research frontier:

  • TEM composition: Determining which other tetraspanins and associated proteins co-exist with Tspan5 in neuronal TEMs would provide insights into its functional context.

  • Membrane organization: Investigation of how Tspan5 influences the nanoscale organization of AMPARs and associated proteins within the plasma membrane could be pursued using super-resolution microscopy techniques.

  • Lipid interactions: Given tetraspanins' association with cholesterol-rich membranes , exploring how lipid composition affects Tspan5 function could reveal regulatory mechanisms.

  • Homodimerization and heterodimerization: Determining whether Tspan5 forms homo- or heterodimers with other tetraspanins would provide insights into the assembly and function of TEMs.

  • TEM dynamics: Investigating how neural activity affects the composition and stability of Tspan5-containing TEMs could reveal activity-dependent regulatory mechanisms.

These advanced questions represent frontier areas in Tspan5 research, building upon the established roles in AMPAR trafficking to understand broader implications for neuronal function and plasticity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.