Recombinant Rat Thromboxane A2 receptor (Tbxa2r)

Shipped with Ice Packs
In Stock

Description

Production and Expression

Recombinant rat Tbxa2r is typically produced using E. coli expression systems for cost-effective scalability . Key steps include:

  1. Cloning: Full-length Tbxa2r cDNA inserted into bacterial vectors.

  2. Induction: IPTG-induced expression under T7/lac promoter systems.

  3. Purification: Affinity chromatography (e.g., His-tag) and refolding for functional conformation .

Critical Quality Metrics

  • Purity: >90% by SDS-PAGE

  • Activity: Validated via ligand-binding assays (e.g., radiolabeled TXA2 analogs)

Signaling Mechanisms

  • Primary pathway: Activates Gαq/11 and Gα12/13 subunits → stimulates phospholipase C (PLC) → increases intracellular Ca²⁺ .

  • Secondary effects:

    • RhoA/ROCK activation → cytoskeletal remodeling

    • Modulation of adenylyl cyclase (isoform-dependent)

Biological Roles

  • Platelet aggregation: Mediates TXA2-induced platelet activation .

  • Vasoconstriction: Regulates renal and pulmonary vascular tone .

  • Cancer progression: Enhances triple-negative breast cancer (TNBC) metastasis via ERM protein activation .

Key Studies Using Recombinant Rat Tbxa2r

Study FocusFindingsCitation
Thrombosis modelsIdentified ROCK inhibitors as anti-metastatic agents in TNBC
GPCR dimerizationDemonstrated functional heterodimerization with IP receptors
Renal pathophysiologyLinked TXA2-R activation to glomerular vasoconstriction

Therapeutic Targeting

  • Antagonists: Ramatroban (Phase 2/3 for allergic rhinitis)

  • Inhibitors: Rho-associated kinase (ROCK) inhibitors show efficacy in TNBC models

Clinical Trials Involving Tbxa2r Modulators

DrugPhaseIndicationMechanism
Ifetroban sodiumPhase 2ThrombosisTXA2-R antagonist
KP-496Phase 2AsthmaDual TXA2-R/CRTH2 antagonist

Challenges and Limitations

  • Structural instability: Requires detergent solubilization for in vitro studies .

  • Species-specificity: Rat Tbxa2r exhibits 85% homology to human TBXA2R, limiting direct translational relevance .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have any specific format requirements, please indicate them in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
Tbxa2r; Thromboxane A2 receptor; TXA2-R; Prostanoid TP receptor; TXR2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-341
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MWLNSTSLGACFRPVNITLQERRAIASPWFAASFCALGLGSNLLALSVLAGARPGAGPRS SFLALLCGLVLTDFLGLLVTGAVVASQHAALLDWRATDPGCRLCHFMGAAMVFFGLCPLL LGAAMAAERFVGITRPFSRPAATSRRAWATVGLVWVGAGTLGLLPLLGLGRYSVQYPGSW CFLTLGAERGDVAFGLMFALLGSVSVGLSLLLNTVSVATLCRVYHAREATQRPRDCEVEM MVQLVGIMVVATVCWMPLLVFILQTLLQTLPVMSPSGQLLRTTERQLLIYLRVATWNQIL DPWVYILFRRSVLRRLHPRFTSQLQAVSLHSPPTQAMLSGP
Uniprot No.

Target Background

Function
Receptor for thromboxane A2 (TXA2), a potent stimulator of platelet aggregation. The activity of this receptor is mediated by a G-protein that activates a phosphatidylinositol-calcium second messenger system. In the kidney, the binding of TXA2 to glomerular TP receptors causes intense vasoconstriction. Activates phospholipase C and adenylyl cyclase.
Gene References Into Functions
  1. We conclude that hyperglycemia activates thromboxane A2 receptor to impair the integrity and function of blood-brain barrier via the ROCK-PTEN-Akt-eNOS pathway. PMID: 28415790
  2. Data suggest that thromboxane A2/Tbxa2r-mediated vasoconstriction of intracavernous small penile arteries depends on Ca2+ influx through L-type calcium channels and TRP (transient receptor potential) channels, and ROCK- (Rho kinase)-dependent mechanisms in vascular smooth muscle. PMID: 26708952
  3. The experiments suggest that in the SHR but not the WKY aorta, alpha1 -adrenoceptor activation desensitizes TP receptors through activation of PKC-epsilon. PMID: 25857252
  4. Low-dose TP stimulation constricts the ductus arteriosus with minimal adverse effects at least in rat neonates. PMID: 22717688
  5. analysis of hypersensitivity to the thromboxane receptor mediated cerebral vasomotion and CBF oscillations during acute NO-deficiency in rats PMID: 21217826
  6. vasoconstrictor TP receptor and MaxiK-channel direct interaction facilitates G-protein-independent TP to MaxiK trans-inhibition, which would promote vasoconstriction. PMID: 20959415
  7. Here we examined a role of PPAR-gamma in TXR gene expression in VSMCs PMID: 11777901
  8. These results suggest that the impaired functional vasodilation in diabetic rats is due to hyperglycemia-mediated increases in TP-mediated vasoconstriction. PMID: 16905600
  9. post-transcriptional mechanisms are responsible for the up-regulation of TP receptor by lipid soluble smoke particles, in which enhanced translation is the major cause of the elevated protein expression and the enhanced contraction. PMID: 17706224
  10. These studies demonstrated that thromboxane A(2) receptorss couple to both G(q) and G(13) in the extranuclear compartment but only to G(s) in the nuclear compartment. PMID: 18710937
  11. Transcriptional down-regulation of thromboxane A(2) receptor expression via activation of MAPK ERK1/2, p38/NF-kappaB pathways. PMID: 18769070
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
In the brain, expressed in all types of glial cells. In the kidney, expressed in the mesangial cells of the glomerulus, smooth muscle cells of the renal arterioles, and in transitional cell epithelium of renal pelvis.

Q&A

What is the rat Thromboxane A2 receptor (Tbxa2r) and how does it function?

The rat Thromboxane A2 receptor (Tbxa2r) is a G protein-coupled receptor (GPCR) that serves as the primary receptor for thromboxane A2 (TXA2), a potent autocrine signaling molecule. This receptor mediates its effects through activation of multiple G protein pathways, primarily Gq/11 and G12/13 heterotrimeric G proteins, which subsequently activate downstream signaling proteins including phospholipase C and RhoA to promote various cellular responses . In platelets, this signaling cascade leads to platelet aggregation, while in kidney glomerular cells, Tbxa2r activation causes intense vasoconstriction . The receptor is also expressed in steroidogenic tissues such as testicular Leydig cells, where it participates in the regulation of steroid hormone biosynthesis through modulation of the steroidogenic acute regulatory (StAR) gene expression .

What experimental methods are available for detecting rat Tbxa2r expression in tissue samples?

For researchers investigating rat Tbxa2r expression, several methodological approaches are recommended:

  • Western Blot Analysis: Using specific antibodies such as rabbit polyclonal antibodies against Tbxa2r, researchers can detect receptor protein expression in rat tissue lysates. Typical protocols involve running 20-50 μg of total protein on SDS-PAGE, followed by transfer to nitrocellulose or PVDF membranes .

  • Immunohistochemistry (IHC): Paraffin-embedded tissue sections can be analyzed using IHC-compatible antibodies to visualize Tbxa2r cellular localization. This method reveals subcellular distribution patterns, particularly the cytoplasmic localization of the receptor .

  • RT-PCR and qPCR: These techniques allow quantitative assessment of Tbxa2r mRNA expression levels, which is particularly useful when evaluating receptor regulation under different experimental conditions .

  • Radioligand Binding Assays: Using selective thromboxane A2 receptor agonists or antagonists with radioactive labels, researchers can quantify receptor density and binding characteristics in membrane preparations from rat tissues .

Each detection method offers unique advantages, and selection should be based on the specific research question, available equipment, and the nature of the samples being analyzed.

How can recombinant rat Tbxa2r be utilized in functional studies?

Functional studies utilizing recombinant rat Tbxa2r can be implemented through several experimental approaches:

  • Receptor Antagonist Studies: Selective antagonists such as SQ29548 or BM567 can be employed in dose-dependent experimental designs to block Tbxa2r activity. These studies have revealed that antagonist treatment results in increased StAR protein expression and enhanced steroid production in Leydig cells .

  • Promoter Activity Assays: Recombinant systems expressing Tbxa2r can be used with reporter constructs (e.g., luciferase driven by the StAR promoter) to assess the receptor's role in gene transcription. This approach has demonstrated that blocking Tbxa2r significantly enhances StAR promoter activity .

  • RhoA Activation Assays: Since Tbxa2r activates RhoA signaling, ELISA-based or pull-down assays measuring active RhoA-GTP can quantify receptor activity. Inhibition studies using ROCK inhibitors can further delineate the pathway's contribution to cellular phenotypes .

  • Migration and Invasion Assays: Recombinant Tbxa2r expression in cellular models allows assessment of its impact on cell motility, using Boyden chamber or wound healing assays. Such studies have revealed that Tbxa2r enhances cell migration and invasion capabilities through Rho signaling pathways .

  • Reactive Oxygen Species (ROS) Measurement: Fluorescent probes for ROS detection can be used to evaluate how Tbxa2r modulates oxidative stress responses, as the receptor has been shown to protect cells from DNA damage by negatively regulating ROS levels .

What are the critical parameters for successful expression of functional recombinant rat Tbxa2r?

Successful expression of functional recombinant rat Tbxa2r requires careful optimization of several parameters:

  • Expression System Selection: Mammalian expression systems (particularly HEK293 or CHO cells) are preferred over bacterial systems to ensure proper post-translational modifications and folding of the receptor. These modifications are crucial for maintaining the receptor's native conformation and signaling capabilities.

  • Vector Design Considerations:

    • Inclusion of appropriate signal sequences to facilitate membrane targeting

    • Addition of epitope tags (e.g., FLAG, HA) for detection without disrupting receptor function

    • Use of inducible promoters to control expression levels, preventing potential cytotoxicity from overexpression

  • Membrane Integration Validation: Confirmation of proper membrane localization using subcellular fractionation techniques or confocal microscopy with fluorescently tagged constructs is essential, as mislocalized receptors may fail to signal properly.

  • Functional Validation Methods:

    • Ligand binding assays to confirm agonist/antagonist binding capabilities

    • Second messenger assays (calcium mobilization, inositol phosphate accumulation)

    • G-protein coupling evaluation using [35S]GTPγS binding assays

  • Stable vs. Transient Expression: While transient transfection is suitable for initial studies, stable cell lines are recommended for consistent long-term experiments, particularly when studying subtle signaling effects or conducting high-throughput screening.

How does rat Tbxa2r interact with G-protein-mediated signaling pathways?

Rat Tbxa2r activates multiple G-protein-mediated signaling pathways with distinct downstream effects:

Gq/11 Pathway:

  • Activates phospholipase C (PLC), leading to hydrolysis of phosphatidylinositol 4,5-bisphosphate (PIP2) into inositol 1,4,5-trisphosphate (IP3) and diacylglycerol (DAG)

  • IP3 triggers calcium release from intracellular stores

  • DAG activates protein kinase C (PKC)

  • This pathway is critical for platelet activation and vasoconstriction responses

G12/13 Pathway:

  • Activates RhoA through guanine nucleotide exchange factors (GEFs)

  • Leads to cytoskeletal reorganization via Rho-associated protein kinase (ROCK)

  • Critical for cell migration, invasion, and shape changes

  • Particularly important in cancer cell metastasis and platelet aggregation

Isoform-Specific Signaling:

  • Isoform 1 activates adenylyl cyclase, increasing cAMP levels

  • Isoform 2 inhibits adenylyl cyclase, decreasing cAMP levels

  • These differential effects on cAMP signaling allow for context-specific cellular responses

What is the relationship between rat Tbxa2r and the regulation of steroidogenesis?

Rat Tbxa2r plays a significant inhibitory role in steroidogenesis through several connected mechanisms:

  • Negative Regulation of StAR Expression: Tbxa2r activation inhibits steroidogenic acute regulatory (StAR) protein expression, which is critical for cholesterol transfer to the inner mitochondrial membrane—the rate-limiting step in steroidogenesis .

  • DAX-1 Modulation: Tbxa2r signaling maintains elevated levels of dosage-sensitive sex reversal-adrenal hypoplasia congenita critical region on the X chromosome, gene 1 (DAX-1) protein, a transcriptional repressor of StAR gene expression. Blocking the receptor with antagonists reduces DAX-1 protein levels, thereby relieving this repression and enhancing StAR expression .

  • Cyclooxygenase-2 (COX2) Pathway Integration: Tbxa2r functions as part of the arachidonic acid metabolic pathway, specifically downstream of COX2 and thromboxane A synthase (TBXAS). This pathway generates thromboxane A2, which signals through Tbxa2r to complete a negative feedback loop regulating steroid production .

  • Age-Related Effects: In aging Leydig cells, blocking Tbxa2r can delay the decline in StAR protein expression and testosterone biosynthesis, suggesting a role for this receptor in age-related changes in steroidogenic capacity .

This regulatory mechanism represents a potential therapeutic target for conditions involving disrupted steroidogenesis, including certain forms of male infertility and age-related testosterone decline.

How are genetic variants of Tbxa2r implicated in disease models and translational research?

Genetic variants of Tbxa2r have significant implications for disease modeling and translational research across multiple systems:

Bleeding Disorders:
Naturally occurring variants in the TBXA2R gene have been associated with bleeding disorders due to abnormal platelet function. Several specific mutations have been characterized:

  • Asp304Asn Substitution: Located within the highly conserved NPXXY motif in transmembrane domain 7 (TMD7), this variant reduces TXA2-mediated platelet activation due to compromised ligand binding .

  • Trp29Cys Substitution: Found in TMD1, this variant is associated with abnormal postsurgical bleeding and reduced receptor-mediated platelet activation. The mutation primarily affects receptor trafficking, reducing cell surface expression without altering total receptor levels .

  • Val80Glu Substitution: Reduces TPα receptor activation in megakaryocyte models .

  • Ala160Thr Substitution: Increases activation responses, potentially conferring constitutive activity that could promote platelet hyperactivity and increase cardiovascular disease risk .

Cancer Research:
In rodent models of triple-negative breast cancer (TNBC), Tbxa2r has been identified as a potential driver of tumor cell survival and metastasis:

  • Enhanced Migration and Invasion: Tbxa2r activation promotes tumor cell migration and invasion through Rho signaling pathways .

  • Protection from DNA Damage: The receptor negatively regulates reactive oxygen species levels, potentially protecting cancer cells from oxidative stress-induced DNA damage .

  • BRCA1 Regulation: Tbxa2r expression is regulated by BRCA1, with c-Myc being required for BRCA1-mediated transcriptional repression, suggesting a complex regulatory network in cancer biology .

These findings highlight the potential value of Tbxa2r as both a disease biomarker and therapeutic target across multiple pathological conditions.

What methodological approaches can be used to study Tbxa2r antagonism in experimental disease models?

When investigating Tbxa2r antagonism in disease models, researchers can employ several methodological approaches:

In Vitro Methods:

  • Selective Antagonist Studies:

    • Competitive binding assays using SQ29548 or BM567 to determine receptor occupancy

    • Dose-response curves in relevant cell types to establish IC50 values

    • Time-course experiments to evaluate the durability of antagonist effects

  • siRNA/shRNA Knockdown:

    • Transient or stable knockdown of Tbxa2r expression

    • Comparison with pharmacological antagonism to distinguish receptor-dependent from receptor-independent effects

  • CRISPR/Cas9 Gene Editing:

    • Generation of receptor-null cell lines

    • Introduction of specific mutations to mimic naturally occurring variants

Ex Vivo Methods:

  • Isolated Tissue Preparations:

    • Platelet aggregation assays using blood from experimental animals

    • Organ bath studies with vascular tissue to assess vasoconstrictor responses

    • Steroidogenic tissue explant cultures to measure hormone production

In Vivo Methods:

  • Disease Model Selection:

    • Thrombosis models: Ferric chloride-induced vascular injury or laser-induced injury models

    • Cancer models: Orthotopic tumor implantation with metastasis assessment

    • Reproductive models: Age-related decline in testosterone production

  • Intervention Strategies:

    • Systemic vs. targeted delivery of antagonists

    • Preventive vs. therapeutic administration protocols

    • Combination approaches with other pathway inhibitors

  • Outcome Measurements:

    • Functional assays specific to the disease model (e.g., bleeding time, tumor growth)

    • Molecular readouts (e.g., StAR expression, RhoA activation)

    • Tissue-specific effects and potential off-target consequences

These methodological approaches provide a comprehensive framework for investigating Tbxa2r antagonism across various disease contexts, facilitating translational research and potential therapeutic development.

How can conflicting data on rat Tbxa2r function be reconciled in different experimental systems?

Reconciling conflicting data on rat Tbxa2r function requires a systematic approach to identifying and addressing experimental variables:

  • Context-Dependent Signaling Analysis:

    • Catalog G-protein coupling preferences across different cell types

    • Measure relative expression levels of signaling components

    • Create pathway activation maps under different experimental conditions

    This approach revealed that in Leydig cells, Tbxa2r primarily signals through inhibitory pathways affecting StAR expression, while in vascular smooth muscle cells, its vasoconstrictive effects predominate .

  • Receptor Isoform Characterization:

    • Discriminate between isoform-specific effects (isoform 1 activates adenylyl cyclase while isoform 2 inhibits it)

    • Determine relative expression levels of each isoform in the experimental system

    • Develop isoform-selective tools (antibodies, ligands) for specific targeting

  • Methodological Standardization:

    • Establish consensus protocols for receptor expression and functional assays

    • Create standard reference compounds for pharmacological studies

    • Develop validated positive and negative controls for each assay system

  • Integration of Multiple Readouts:

    • Combine direct measurements of receptor activation with downstream pathway analysis

    • Correlate pharmacological antagonism with genetic knockdown/knockout approaches

    • Apply systems biology approaches to model complex pathway interactions

  • Cross-Validation Across Model Systems:

    • Compare findings between different cell lines, primary cultures, and in vivo models

    • Benchmark rodent data against human receptor studies for translational relevance

    • Use multiple antagonists/agonists with different chemical structures to confirm specificity

By systematically addressing these factors, researchers can develop a more coherent understanding of Tbxa2r function that accounts for apparent contradictions in the literature.

What emerging technologies are advancing the study of Tbxa2r structure-function relationships?

Several cutting-edge technologies are transforming our understanding of Tbxa2r structure-function relationships:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Allows visualization of receptor conformational states in near-native conditions

    • Provides insights into ligand binding pockets and G-protein coupling interfaces

    • Enables structure-based drug design for novel Tbxa2r modulators

  • GPCR-Specific Biosensors:

    • FRET/BRET-based sensors report real-time conformational changes

    • Allow distinction between different active states of the receptor

    • Enable high-throughput screening in living cells to identify state-selective ligands

  • HDX-MS (Hydrogen-Deuterium Exchange Mass Spectrometry):

    • Reveals dynamic aspects of receptor structure not captured by static methods

    • Identifies regions undergoing conformational changes upon ligand binding

    • Particularly valuable for mapping allosteric modulation sites

  • Advanced Molecular Dynamics Simulations:

    • Predicts receptor behavior in different membrane environments

    • Models interaction with various ligands and G-proteins

    • Provides hypotheses for experimental validation of structure-function relationships

  • Nanobody Technology:

    • Develops conformation-specific nanobodies that stabilize specific receptor states

    • Facilitates crystallization of otherwise challenging conformational states

    • Creates tools for selective manipulation of receptor signaling in vivo

  • Site-Specific Fluorescent Labeling:

    • Introduces minimally disruptive fluorescent probes at key positions

    • Monitors local conformational changes during activation

    • Allows single-molecule studies of receptor dynamics

These technologies are particularly valuable for understanding how genetic variants in Tbxa2r, such as those found in the NPXXY motif (Asp304Asn) or in TMD1 (Trp29Cys), alter receptor function at the molecular level, providing insights that can guide therapeutic development for conditions ranging from bleeding disorders to cancer .

Comparative Analysis of Tbxa2r Antagonists Used in Research

AntagonistChemical ClassIC50 (nM)Selectivity ProfilePrimary Research ApplicationsReference
SQ29548Prostanoid analog12.6 ± 2.4High selectivity for TP receptorsPlatelet function, steroidogenesis
BM567Torasemide derivative4.8 ± 1.2Dual TP/TXA synthase inhibitorReproductive biology, vascular studies
GR32191Prostanoid analog7.3 ± 1.8TP receptor selectiveThrombosis models, vascular function
ICI192605Sulphonamide1.9 ± 0.6Highly selective TP antagonistPlatelet aggregation, vascular tone
RamatrobanBenzene sulfonamide30.2 ± 6.7Dual TP/DP2 antagonistRespiratory models, platelet function

Effects of Tbxa2r Genetic Variants on Receptor Function

VariantLocationFunctional EffectPhenotypic ConsequenceMolecular MechanismReference
Asp304AsnTMD7 (NPXXY motif)↓ Ligand bindingBleeding tendencyDisruption of binding pocket integrity
Trp29CysTMD1↓ Surface expressionPostsurgical bleedingImpaired anterograde trafficking
Val80GluECL1↓ Receptor activationReduced platelet responseUnknown
Ala160ThrTMD4↑ Receptor activationPotential hyperactivityPossible constitutive activity
Arg60LeuICL1↓ G-protein couplingBleeding disorderDisrupted G-protein interface

Pathway-Specific Effects of Tbxa2r Activation in Different Tissues

Tissue TypePrimary G-protein PathwayKey Downstream EffectorsPhysiological OutcomeReference
PlateletsGq/11, G12/13PLC, RhoA, calcium mobilizationPlatelet aggregation, thrombus formation
Vascular Smooth MuscleGq/11PLC, calcium mobilization, MLCKVasoconstriction
Kidney (Glomeruli)Gq/11PLC, IP3, calciumIntense vasoconstriction
Leydig CellsGq/11DAX-1 upregulationInhibition of StAR expression and steroidogenesis
Breast Cancer CellsG12/13RhoA, ROCK, ERM proteinsEnhanced migration, invasion, metastasis
Immune CellsGq/11, GiPLC, cAMP inhibitionPro-inflammatory effects

What are the most promising avenues for developing selective modulators of rat Tbxa2r?

Future development of selective Tbxa2r modulators may focus on several promising strategies:

  • Biased Ligand Development:

    • Design of pathway-selective agonists/antagonists that preferentially activate or inhibit specific G-protein coupling

    • This approach could allow targeting of pathological Tbxa2r signaling while preserving beneficial physiological functions

  • Allosteric Modulator Exploration:

    • Identification of binding sites distinct from the orthosteric (TXA2-binding) pocket

    • Development of positive or negative allosteric modulators that fine-tune receptor response to endogenous ligands

    • This strategy may offer improved selectivity over orthosteric antagonists

  • Isoform-Selective Compounds:

    • Design of compounds that selectively target either isoform 1 or isoform 2 of Tbxa2r

    • This approach would allow specific modulation of either adenylyl cyclase activation or inhibition

  • Context-Dependent Inhibitors:

    • Development of pro-drugs or compounds activated in specific tissue environments

    • Design of inhibitors selectively targeting disease-associated receptor conformations

  • RNA-Based Therapeutic Approaches:

    • siRNA or antisense oligonucleotides targeting Tbxa2r expression

    • These approaches could provide tissue-specific inhibition through targeted delivery systems

Each of these strategies offers unique advantages for developing next-generation modulators with improved efficacy and reduced side effects compared to current non-selective approaches like aspirin that inhibit the entire prostanoid synthesis pathway .

How might systems biology approaches enhance our understanding of Tbxa2r in complex disease models?

Systems biology approaches offer powerful frameworks for integrating Tbxa2r function within larger biological contexts:

  • Multi-Omics Integration:

    • Combining transcriptomics, proteomics, and metabolomics data to build comprehensive pathway maps

    • Identifying unexpected connections between Tbxa2r and other signaling networks

    • Revealing tissue-specific regulatory mechanisms governing receptor expression and function

  • Mathematical Modeling of Signaling Networks:

    • Developing quantitative models that predict the outcomes of Tbxa2r modulation

    • Simulating network perturbations to identify critical nodes and potential compensatory mechanisms

    • Optimizing intervention strategies through in silico testing before experimental validation

  • Single-Cell Analysis Technologies:

    • Characterizing cell-to-cell variability in Tbxa2r expression and signaling

    • Identifying rare cell populations that may drive disease phenotypes

    • Tracking dynamic changes in receptor function during disease progression

  • Network Pharmacology Approaches:

    • Mapping the polypharmacology of Tbxa2r modulators across multiple targets

    • Identifying synergistic drug combinations that modulate different parts of the signaling network

    • Predicting and mitigating potential side effects through network analysis

  • Temporal Dynamics Analysis:

    • Studying the time-dependent aspects of Tbxa2r signaling using high-temporal resolution techniques

    • Understanding adaptation, desensitization, and resensitization mechanisms

    • Characterizing the kinetics of different downstream pathways to identify therapeutic windows

These systems-level approaches are particularly valuable for understanding complex phenotypes like the role of Tbxa2r in cancer progression, where the receptor's effects on migration, invasion, and protection from DNA damage involve multiple interacting pathways .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.