Recombinant Rat Toll-like receptor 4 (Tlr4), partial

Shipped with Ice Packs
In Stock

Product Specs

Buffer
For liquid delivery forms, the default storage buffer is a Tris/PBS-based buffer containing 5%-50% glycerol.

**Note:** If you have specific requirements regarding the glycerol content, please indicate them in your order remarks.
Form
Available delivery forms: Liquid or Lyophilized powder.

**Note:** We prioritize shipping the format currently in stock. However, if you have a specific format preference, please mention it in your order remarks and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time information.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50% and serves as a reference point.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.

Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Synonyms
Tlr4; Toll-like receptor 4; Toll4; CD antigen CD284
Datasheet & Coa
Please contact us to get it.
Expression Region
26-638aa
Mol. Weight
90.2kDa
Protein Length
Extracellular Domain
Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Immunology
Source
in vitro E.coli expression system
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
NPCIEVLPNITYQCMDQNLSKIPHDIPYSTKNLDLSFNPLKILRSYSFTNFSQLQWLDLSRCEIETIEDKAWHGLNQLSTLVLTGNPIKSFSPGSFSGLTNLENLVAVETKMTSLEGFHIGQLISLKKLNVAHNLIHSFKLPEYFSNLTNLEHVDLSYNYIQTISVKDLQFLRENPQVNLSLDLSLNPIDSIQAQAFQGIRLHELTLRSNFNSSNVLKMCLQNMTGLHVHRLILGEFKNERNLESFDRSVMEGLCNVSIDEFRLTYINHFSDDIYNLNCLANISAMSFTGVHIKHIADVPRHFKWQSLSIIRCHLKPFPKLSLPFLKSWTLTTNREDISFGQLALPSLRYLDLSRNAMSFRGCCSYSDFGTNNLKYLDLSFNGVILMSANFMGLEELEYLDFQHSTLKKVTEFSVFLSLEKLLYLDISYTNTKIDFDGIFLGLISLNTLKMAGNSFKDNTLSNVFTNTTNLTFLDLSKCQLEQISRGVFDTLYRLQLLNMSHNNLLFLDPSHYKQLYSLRTLDCSFNRIETSKGILQHFPKSLAVFNLTNNSVACICEYQNFLQWVKDQKMFLVNVEQMKCASPIDMKASLVLDFTNSTCYIYKTIISVSVVS
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
Toll-like receptor 4 (TLR4) collaborates with LY96 and CD14 to mediate the innate immune response to bacterial lipopolysaccharide (LPS). It functions through MYD88, TIRAP, and TRAF6, leading to NF-kappa-B activation, cytokine secretion, and the inflammatory response. TLR4 is also involved in LPS-independent inflammatory responses triggered by free fatty acids, such as palmitate.

In complex with TLR6, TLR4 promotes sterile inflammation in monocytes/macrophages in response to oxidized low-density lipoprotein (oxLDL) or amyloid-beta 42. This process is initiated by oxLDL or amyloid-beta 42 binding to CD36. This event induces the formation of a TLR4-TLR6 heterodimer, which is rapidly internalized and triggers an inflammatory response, leading to the NF-kappa-B-dependent production of CXCL1, CXCL2, and CCL9 cytokines (via MYD88 signaling pathway), CCL5 cytokine (via TICAM1 signaling pathway), as well as IL1B secretion. TLR4 binds electronegative LDL (LDL(-)) and mediates the cytokine release induced by LDL(-). Activated by the signaling pathway regulator NMI, which acts as damage-associated molecular patterns (DAMPs) in response to cell injury or pathogen invasion, thus promoting nuclear factor NF-kappa-B activation.
Gene References Into Functions
  1. These data suggest that targeting TLR TIR domains may provide novel pharmacological targets to reduce or reverse TLR4-dependent pain behavior in the rodent. PMID: 28623271
  2. Chronic intermittent hypoxia causes pulmonary inflammatory response and the inflammatory pathway involved in TLR4 receptor may be one of the mechanisms that trigger lung inflammation. PMID: 30293084
  3. TLR4 and NF-kappaB expression, and activation of NF-kappaB are inhibited by dexmedetomidine PMID: 29510084
  4. Data show that the toll-like receptor 4 (TLR4) signaling pathway exerts effects on the expression of apoptosis-related proteins to initiate apoptosis. PMID: 28272417
  5. miR-93-3p showed the protective effects against lipopolysaccharide-induced inflammation and apoptosis in cardiomyocytes by inhibiting TLR4 expression PMID: 30195636
  6. the PI3K/Akt/TLR4 signaling pathway is associated with the antiinflammatory effects of erythropoietin. PMID: 29845292
  7. TLR4 may stimulates synovial inflammatory reactions and increased expression of IL-1beta in rats through the activation of p38 MAPK signaling pathway. PMID: 29944647
  8. The TLR4/PKCalpha/occludin signaling pathway was closely related to blood-brain barrier damage. PMID: 29845266
  9. Both pharmacologic inhibition and genetic knockout of TLR4 completely abolished mesenteric lymph (ML) exosome-induced cytokine production in macrophages. Our findings define the critical role of exosomes secreted into ML as a critical mediator of trauma/hemorrhagic shock-induced acute lung injury through macrophage TLR4 activation. PMID: 28855278
  10. IL-33 may decrease the mortality and inhibit the systematic inflammatory response associated with A. baumannii pneumonia by suppressing TLR4/NF-kappaB signaling. PMID: 29508184
  11. TLR4 knockdown ameliorated neuroinflammatory response and brain injury after traumatic brain injury through suppressing autophagy induction and astrocyte activation. PMID: 29222622
  12. ES of the ear can successfully control epileptic seizures by regulating the TLR4 signaling pathway. PMID: 29682548
  13. Lipopolysaccharide from Rhodobacter sphaeroides inhibits TLR4, attenuating hypersensitivity and modulating nociceptive pain. PMID: 29656686
  14. isoquercetin ameliorated AMI through antiinflammatory and antiapoptotic factors, and regulation of the TLR4NFkappaB signaling pathway. Isoquercetin may therefore potentially exert a protective effect against AMI or other heart diseases. PMID: 29532872
  15. Expression levels of SREBP1 and TLR4 were significantly deceased after EPA treatment. EPA can improve PCOS through the SREBP1/TLR4 pathway. PMID: 29627845
  16. the results of the present study demonstrated that PHC may exert an antiinflammatory effect and attenuate THSinduced ALI by inhibiting the TLR4 signaling pathway. These preclinical findings may offer a novel therapeutic strategy to restrict TLR4 overactivation in ALI. PMID: 29488614
  17. The combination of Ligusticum chuanxiong and Radix Paeoniae protects against focal cerebral ischaemia via TLR4/MyD88/MAPK/NF-kappaB signalling pathway in rat model of middle cerebral artery stroke. PMID: 29193143
  18. There were significant differences in inflammation and apoptosis, including the expression of RACK1 and TLR4, after myocardial IRI between the propofol and isoflurane groups PMID: 29511370
  19. TLR4/MyD88/NF-kappaB signaling participates in the inflammatory response of the myocardium after Coronary microembolization (CME), activating the NLRP3 inflammasome, promoting the inflammatory cascade, and aggravating myocardial injury. Blocking TLR4/MyD88/NF-kappaB signaling may help reduce myocardial injury and improve cardiac function after CME. PMID: 29940584
  20. Studied protective effect on cardiomyocytes of dexamedetomidine (DEX) against hypoxia/reoxygenation Injury by suppression of TLR4-MyD88-NF-kappaB Signaling. Demonstrated that DEX protects at least in part, by TLR4 suppression in TLR4-MyD88-NF-B signaling. PMID: 29359143
  21. MIAT knockdown inhibited AngII-induced cardiac hypertrophy by regulating miR-93/TLR4 axis PMID: 29157986
  22. these findings suggested that dioscin inhibited ischemic strokeinduced inflammation through inhibition of the TLR4/MyD88/NFkBinduced inflammation the rat model, which provided novel insights into the mechanisms underlying the effect of dioscin as an antiinflammatory candidate for the treatment of ischemic stroke in in the future PMID: 29115455
  23. These results suggested that PALM3 contributes to the LPS-induced inflammatory response and participates in LPS-TLR4 signaling in Alveolar macrophages . These data may provide the basis for the development of novel targeted therapeutic strategies of treating acute lung injury. PMID: 29039447
  24. Our findings suggest that the anti-inflammatory actions of sevoflurane postconditioning via inactivation of the TLR-4/NF-kappaB pathway and subsequent reduction in pro-inflammatory cytokine production, in part, contribute to sevoflurane postconditioning-induced neuroprotection after global transient cerebral ischemia in rats. PMID: 29113143
  25. Study concludes, Toll-like receptor 4 (TLR4) and C5aR1 played a vital role during ischemia and reperfusion brain injury in rats, and schisantherin A exhibited neuroprotective effects by TLR4 and C5aR1 signaling pathways. PMID: 28690033
  26. The expression of various inflammatory mediators through Toll-like receptors-4-NF-kappaB downstream signaling pathway. PMID: 28692940
  27. Dexmedetomidine preconditioning inhibited the expression of TLR4 and NF-kappaB and increased that of TRIF. PMID: 28753906
  28. findings indicate that the apoptosis induced by ox-LDL in cultured neonatal rat cardiomyocytes at least in part by modulating the TLR4/NF-kappaB signaling pathway. PMID: 27279424
  29. Toll like receptor 4 activation can be either detrimental or beneficial following mild repetitive traumatic brain injury depending on timing of activation. PMID: 28412141
  30. Related to the down-regulation of the TLR4-meidated NF-kappaB/NLRP3 inflammasome. PMID: 28525945
  31. TLR4 activation in glial cells is integral in brain inflammatory responses to air pollution. PMID: 28410596
  32. Babao Dan attenuates drug-induced hepatic fibrosis by inhibiting hepatic stellate cells activation and proliferation via TLR4 signaling pathway. PMID: 27776340
  33. Morphine amplifies mechanical allodynia via toll-like receptor 4 (TLR4) in a rat model of spinal cord injury. Data suggest that a short course of morphine administered early after spinal trauma can exacerbate central neuropathic pain in the long term. TLR4 initiates this phenomenon. PMID: 27519154
  34. These findings suggested that exercise dampened the secretion of inflammation mediators probably through partial inhibition of TLR4 and p-NF-kappaB and activation of PI3K/p-Akt expression in the spleen. PMID: 27539497
  35. TLR4 plays a critical role in the inflammation and apoptosis of RGCs induced by high glucose. TLR4 might become a novel potential pharmacological target for preventing the progression of DR. PMID: 28808786
  36. miR-146a improves intestine epithelial cells survival under ischemia and I/R injury through inhibition TLR4, TRAF6, and p-IkappaBalpha, subsequently leading to decreased NF-kappaB p65 nuclear translocation. PMID: 28771774
  37. In alcohol preferring rats, TLR4 is localized in ventral tegmental area dopaminergic (TH+) neurons and it upregulates the expression of tyrosine hydroxylase (TH) through a cAMP-dependent protein kinase (PKA)/cyclic AMP response element binding protein (CREB) signal. PMID: 27187237
  38. ANGPTL2 knockdown ameliorates Diabetic Nephropathy by inhibiting TLR4 expression, an observation contributing to a better understanding of Diabetic Nephropathy pathogenesis. PMID: 28946139
  39. These results indicated that TLR4 and P2X4R pathways mediated IL-1beta synthesis and release in microglia followed chronic morphine. TLR4 internalization is the main mechanism of morphine-induced microglia activation and IL-1beta release. PMID: 27506813
  40. The TLR4/NF-kB signalling pathway was activated in the tooth germs of offspring of diabetic dams. PMID: 27981756
  41. the upregulation of TLR4 expression via PKC activation contributes to defective wound healing in high-glucose-treated kidney tubular cells PMID: 28542370
  42. Intraventricular hemorrhage-induced hypersecretion of CSF is mediated by TLR4-dependent activation of SPAK, which binds, phosphorylates, and stimulates the NKCC1 co-transporter at the CPE apical membrane. PMID: 28692063
  43. sSudy shows that SAHA can suppress seizure-induced microglia activation and neuron apoptosis, and inhibit TLR4 expression through histone acetylation regulation by inhibiting TLR4/MYD88 signaling. This strongly suggests a potential neuroprotective effect of SAHA against neuroinflammation-induced brain damage. These findings provide new insights into the treatment of epilepsy and other neurodegenerative disorders. PMID: 27193049
  44. IL-10 helps to maintain heart function during stress via myeloid differentiation gene 88/IRAK-4/IRAK-1-dependent TLR4 signaling. PMID: 28432060
  45. Short bowel syndrome rats showed a significant increase in TLR4 and TRAF6 mRNA in jejunum and ileum, TLR4 and MyD88 protein expression in jejunum and ileum, and a significant increase in the number of TLR4 and TRAF6 positive cells (immunohistochemistry) compared to sham animals. PMID: 26895894
  46. Although TLR4 was not a critical determinant of excessive drinking, it was important in the acute sedative effects of PMID: 27986929
  47. The results indicated that inflammatory injury and pathological and ultrastructural damage in rat lungs exposed to PM2.5 plus SO2 were involved in TLR4/p38/NF-kappaB pathway activation accompanied by oversecretion of pro-inflammatory cytokine, adhesion molecule, and NO PMID: 28033732
  48. The expression of TLR4 and TRAF6 was gradually increased with increasing intestinal ischemia duration, but increased substantially after ischemia-reperfusion injury. After ischemic preconditioning, TLR4 and TRAF6 expressions decreased; however, expression of SOCS-1 and the TLR4-TRAF6 pathway inhibitor was increased. PMID: 27538408
  49. these findings indicate that modifying TLR4 gene expression in the periaqueductal gray stimulates expression of the downstream signaling molecule, GAD67, which decreases Glu levels and increases GABA levels. This mechanism may explain the inhibition of withdrawal syndrome in morphine-dependent rats. PMID: 28306133
  50. TAK-242 can effectively improve coronary microembolization -induced cardiac dysfunction by regulating TLR4/NF-kappaB signaling pathway and then reducing the myocardial apoptosis. PMID: 28359050

Show More

Hide All

Database Links
Protein Families
Toll-like receptor family
Subcellular Location
Cell membrane; Single-pass type I membrane protein. Early endosome. Cell projection, ruffle.

Q&A

What is rat TLR4 and what distinguishes it from TLR4 in other species?

Rat TLR4 is a pattern recognition receptor (PRR) that belongs to the toll-like receptor family and plays a central role in innate immunity. Like TLR4 in other species, rat TLR4 recognizes bacterial lipopolysaccharide (LPS), a major component of Gram-negative bacterial cell walls, along with several other pathogen components and endogenous molecules produced during tissue damage .

For researchers, understanding these species-specific differences is critical when designing experiments and interpreting results, especially when considering the translational relevance of findings from rat models to human applications.

What are the key structural components of rat TLR4 and their functions?

Rat TLR4, similar to TLR4 in other species, comprises several distinct domains with specific functions:

  • Extracellular leucine-rich repeat (LRR) domain: This region is responsible for ligand recognition and binding. The LRR domain is highly polymorphic across species, contributing to differences in ligand specificity .

  • Transmembrane domain: A relatively short segment that anchors the receptor in the cell membrane.

  • Intracellular Toll/interleukin-1 (IL-1) receptor-like (TIR) domain: This highly conserved domain is crucial for signal transduction by interacting with adapter proteins to initiate downstream signaling cascades .

The functionality of rat TLR4 depends not only on these domains but also on its association with co-receptor molecules, particularly MD-2 (myeloid differentiation factor 2). The TLR4/MD-2 complex forms the functional unit that recognizes and binds LPS . Evidence suggests that MD-2 partially determines the binding specificity of the TLR4/MD-2 receptor complex for LPS variants, potentially affecting TLR4 function across different animal species .

What expression systems are most effective for producing recombinant rat TLR4?

The choice of expression system for recombinant rat TLR4 significantly impacts protein quality and functionality. Based on research practices in the field, the following systems have proven effective:

  • Mammalian cell expression systems: Cell lines like HEK293 and CHO cells are frequently used for expressing recombinant rat TLR4 . These systems provide proper folding and post-translational modifications that closely resemble native rat TLR4. For instance, research has employed CHO cells expressing human TLR4 and MD-2 for binding assays , suggesting similar approaches would be applicable for rat TLR4.

  • Baculovirus-insect cell systems: This approach offers a compromise between proper eukaryotic protein processing and higher yields compared to mammalian systems.

  • Cell-free systems: For structural studies of specific domains of rat TLR4, cell-free expression systems may be utilized.

The selection of an appropriate expression system should consider several factors:

  • The intended application of the recombinant protein (functional studies vs. structural analysis)

  • Required post-translational modifications

  • The need for co-expression with cofactors like MD-2

  • Yield requirements

For functional studies, mammalian expression systems are generally preferred as they ensure proper folding, glycosylation, and interaction with cofactors like MD-2, which is essential for LPS recognition .

How can binding affinity of ligands to recombinant rat TLR4 be accurately measured?

Several methodologies have been established for measuring the binding affinity of ligands to recombinant rat TLR4:

  • Surface Plasmon Resonance (SPR): This technique allows real-time analysis of binding interactions without labeling requirements. In SPR studies, recombinant TLR4-MD-2 complex can be immobilized on a sensor chip to determine affinity and kinetic parameters of various ligands . For example, Biacore systems have been used to measure binding kinetics between TLR4/MD-2 complexes and potential ligands, determining association (kon) and dissociation (koff) rates, as well as the equilibrium dissociation constant (KD) .

  • FACS-based binding assays: Flow cytometry can be employed to quantify binding of ligands to cells expressing recombinant rat TLR4. This approach has been used with CHO cells expressing TLR4 and MD-2, where antibodies like 15C1 were incubated at different concentrations, followed by detection with fluorescent anti-idiotype antibodies .

  • Competitive binding assays: These assays assess the ability of test compounds to compete with known ligands (e.g., LPS) for binding to recombinant rat TLR4, providing insights into binding site preferences and relative affinities.

  • Reporter cell assays: Cells expressing recombinant rat TLR4 and a reporter gene (e.g., NF-κB-dependent luciferase or secreted alkaline phosphatase) can indirectly measure binding through functional activation .

The choice of method depends on the specific research question, with SPR providing detailed kinetic information, while cell-based assays offer insights into the functional consequences of binding in a more physiological context.

What are the most reliable methods for assessing rat TLR4 activation in experimental systems?

Several robust methods have been established for assessing rat TLR4 activation:

  • Reporter gene assays: Cell lines transfected with rat TLR4 and a reporter gene under the control of NF-κB-responsive elements provide a straightforward readout of TLR4 activation . For example, HEK cells stably transfected with TLR4 and a secreted alkaline phosphatase (SEAP) reporter have been used to monitor NF-κB activation in response to TLR4 ligands .

  • Cytokine production measurement: Quantification of pro-inflammatory cytokines (e.g., IL-6, IL-8, TNF-α) by ELISA or Luminex following stimulation of cells expressing rat TLR4 provides a functional readout of receptor activation .

  • Western blotting for phosphorylated signaling molecules: Detection of phosphorylated signaling proteins downstream of TLR4 activation (e.g., p38 MAPK, ERK, JNK, IκB) can provide insights into pathway-specific activation.

  • FRET (Fluorescence Resonance Energy Transfer) studies: This technique has been employed to study TLR4 dimerization and interaction with adapter proteins upon ligand binding, using antibodies conjugated to fluorophores like Cy3 or Cy5 .

  • Dose-response analyses: Comparing activation curves between different ligands can identify partial agonists versus full agonists of TLR4 . For instance, studies with ornithine lipid have shown it acts as a partial TLR4 agonist, activating the receptor alone but inhibiting LPS-induced TLR4 signaling at certain concentrations .

When designing experiments to assess rat TLR4 activation, researchers should consider including appropriate positive controls (e.g., LPS) and negative controls (e.g., cells lacking TLR4 expression or TLR4 antagonists).

How can researchers differentiate between direct and indirect activation of rat TLR4?

Differentiating between direct and indirect activation of rat TLR4 is crucial for accurately characterizing potential ligands and understanding signaling mechanisms:

  • Reconstitution systems: Using cell lines that lack endogenous TLR4 expression (e.g., HEK293) transfected with rat TLR4 and essential co-receptors provides a clean background to assess direct activation. For example, HEK cells stably transfected with TLR4 have been used to demonstrate that ornithine lipid (OL) directly activates TLR4 when administered alone .

  • Competition assays: Direct activation can be assessed by examining whether a compound competes with known direct TLR4 ligands such as LPS. Studies have shown that when administered alongside LPS, OL inhibited LPS-induced TLR4 signaling at specific concentrations, suggesting it competes with LPS for the same binding site on TLR4 .

  • Dose-response curves: Comparing activation patterns between putative direct activators and established TLR4 ligands can provide evidence for direct activation. Full agonists typically show higher maximal activation compared to partial agonists of TLR4 .

  • Use of TLR4 antagonists: Specific TLR4 antagonists should block direct but not indirect activation of TLR4-dependent pathways.

  • Structural biology approaches: Techniques like X-ray crystallography or cryo-EM can provide definitive evidence of direct binding between a ligand and the TLR4/MD-2 complex.

It's important to note that many endogenous molecules proposed as TLR4 activators may act indirectly or require additional cofactors. For instance, the proposed activation of TLR4 by fatty acids has been controversial, as some reports suggest it might involve contamination by LPS or might be mediated by lipoproteins acting as shuttle molecules for LPS .

How does rat TLR4 contribute to inflammatory liver disease models?

Rat TLR4 plays a significant role in inflammatory liver disease models, affecting multiple aspects of disease progression:

  • Expression in liver cells: TLR4 is expressed by all parenchymal and non-parenchymal cell types in the liver, contributing to tissue damage caused by a variety of etiologies . Studies have identified intact TLR4 signaling in hepatic stellate cells (HSCs), the major fibrogenic cell type in injured liver .

  • Fibrogenesis mechanism: TLR4 signaling in HSCs mediates several key responses including:

    • Development of an inflammatory phenotype

    • Promotion of fibrogenesis

    • Anti-apoptotic properties that enhance HSC survival

  • Damage recognition: In the absence of exogenous microbes, endogenous ligands including damage-associated molecular pattern (DAMP) molecules from damaged matrix and injured cells can activate TLR4 signaling in liver cells .

  • Genetic factors: Single nucleotide polymorphisms of the TLR4 gene affect signal transduction and are associated with risks of specific diseases, including cirrhosis in humans . This suggests similar genetic variations might influence disease susceptibility in rat models.

  • Multiple disease etiologies: TLR4 is actively involved in the response to liver injury from various causes, including viral hepatitis, alcoholic and non-alcoholic liver diseases, autoimmune liver diseases, and drug-induced liver diseases .

Understanding the role of rat TLR4 in liver disease models provides valuable insights for developing therapeutic strategies targeting TLR4 signaling in human liver diseases. The mechanistic similarities between rat and human TLR4 in liver pathology make rat models particularly useful for translational research in this field.

What is the significance of partial TLR4 agonism in rat models and how can it be characterized?

Partial TLR4 agonism represents an important immunomodulatory mechanism with significant implications for rat disease models and potential therapeutic applications:

The concept of partial agonism explains some conflicting results in TLR4 research, where certain compounds have been reported to both activate and inhibit TLR4 depending on experimental conditions.

How does rat TLR4 interact with the NLRP3 inflammasome pathway?

The interaction between rat TLR4 and the NLRP3 inflammasome represents an important aspect of inflammatory signaling with implications for numerous disease models:

  • Dual activation mechanisms: Some ligands, such as Ornithine Lipid (OL), have been identified as both TLR4 agonists and NLRP3 inflammasome activators . This dual activity creates complex inflammatory signaling patterns that may be particularly relevant in disease states.

  • Priming and activation: TLR4 signaling often serves as a "priming" signal (Signal 1) for the NLRP3 inflammasome by upregulating NLRP3 and pro-IL-1β expression through NF-κB activation. A second signal (Signal 2) is then required for NLRP3 inflammasome assembly and activation.

  • Direct and indirect activation: Some compounds directly activate TLR4 while indirectly activating NLRP3 through downstream effects of TLR4 signaling . Understanding this relationship is crucial for interpreting experimental results in rat models.

  • Pathophysiological significance: The TLR4-NLRP3 interaction is particularly relevant in:

    • Sterile inflammatory conditions

    • Response to tissue damage

    • Metabolic inflammatory disorders

    • Infectious disease models

  • Methodological considerations: When studying compounds that may affect both pathways, researchers should employ specific inhibitors or genetic approaches to distinguish TLR4-dependent effects from NLRP3-dependent effects. Techniques might include:

    • TLR4 antagonists (e.g., TAK-242)

    • NLRP3 inhibitors (e.g., MCC950)

    • TLR4 or NLRP3 knockout/knockdown approaches

    • Blocking specific downstream signaling components

The cross-talk between TLR4 and the NLRP3 inflammasome represents an important consideration when designing experiments with rat models of inflammatory diseases and when interpreting the effects of potential TLR4-targeting therapeutics.

What are the most significant differences between rat and human TLR4 that impact translational research?

Understanding the differences between rat and human TLR4 is crucial for translational research. Several key differences impact the interpretation and application of research findings:

  • Structural variations:

    • The extracellular leucine-rich repeat (LRR) domains show considerable sequence divergence between rat and human TLR4, affecting ligand recognition and binding

    • The intracellular TIR domains are highly conserved across species, suggesting similar signal transduction pathways

    • Species-specific LRR variants may arise from differences in the ligand-binding process and the roles of TLR4 co-receptor molecules

  • MD-2 interaction differences:

    • Species-specific restrictions in LPS recognition may result from differences in how MD-2 binds to the LRRs of rat versus human TLR4

    • Lizundia et al. described species-specific restrictions in LPS recognition potentially due to differences in the binding of MD-2 to the LRRs of different species' TLR4s

  • Ligand recognition:

    • While both rat and human TLR4 recognize bacterial LPS, they may differ in their affinity and specificity for various LPS chemotypes

    • Recognition of endogenous ligands may vary between species; for example, heat shock proteins are recognized by mouse, rat, and human TLR4, but with potential differences in binding affinity

    • Certain synthetic TLR4 agonists or antagonists may show species-specific activities

  • Expression patterns:

    • Different tissue distribution and cellular expression patterns may exist between rat and human TLR4

    • Regulatory mechanisms controlling TLR4 expression may differ between species

  • Genetic polymorphisms:

    • Human TLR4 displays numerous single nucleotide polymorphisms (SNPs), particularly in the ectodomain, with varied phenotypic effects

    • Rat strains may exhibit strain-specific TLR4 variants that should be considered when selecting experimental models

These differences highlight the importance of cautious interpretation when extrapolating findings from rat models to human applications, particularly in therapeutic development targeting TLR4.

How can the partial recombinant rat TLR4 be utilized for structure-function relationship studies?

Partial recombinant rat TLR4 proteins, containing specific domains rather than the full-length receptor, offer valuable tools for detailed structure-function relationship studies:

  • Domain-specific investigations:

    • Extracellular domain (ECD) constructs: Enable focused studies on ligand binding without interference from membrane constraints or intracellular signaling

    • TIR domain constructs: Allow examination of adapter protein interactions and signaling complex formation

    • Leucine-rich repeat (LRR) subdomains: Permit identification of specific regions responsible for ligand recognition

  • Chimeric receptor approaches:

    • Creating chimeric receptors with domains from different species (e.g., rat ECD with human TIR domain) helps identify species-specific differences in function

    • Such approaches have revealed that species-specific LRR variants in TLR4 may be due to variations in the ligand-binding process and different roles of TLR4 co-receptor molecules

  • Site-directed mutagenesis:

    • Partial constructs allow easier introduction and analysis of specific mutations

    • Targeted mutations in key residues can determine their role in ligand binding, protein-protein interactions, or signal transduction

    • This approach can identify critical residues that differ between rat and human TLR4

  • Structural biology applications:

    • Partial proteins often crystallize more readily than full-length receptors

    • X-ray crystallography or cryo-EM studies of partial recombinant rat TLR4, especially in complex with MD-2 and ligands, provide crucial structural insights

    • Comparing these structures with human TLR4 complexes reveals molecular basis for species-specific responses

  • Protein-protein interaction studies:

    • Partial constructs facilitate the study of specific interactions with co-receptors, adapter proteins, or ligands

    • Methods such as surface plasmon resonance can measure binding kinetics between the TLR4/MD-2 complex and various ligands

These approaches with partial recombinant rat TLR4 are essential for understanding the molecular basis of TLR4 function and for developing more selective TLR4 modulators with therapeutic potential.

What are the best practices for validating the functionality of recombinant rat TLR4 before experimental use?

Ensuring the functionality of recombinant rat TLR4 is crucial for obtaining reliable experimental results. The following validation approaches represent best practices in the field:

  • Structural integrity assessment:

    • SDS-PAGE and Western blotting to confirm correct molecular weight and immunoreactivity

    • Circular dichroism to verify proper protein folding

    • Size exclusion chromatography to evaluate oligomeric state and aggregation

  • Binding capacity verification:

    • Surface plasmon resonance (SPR) to measure binding kinetics to known ligands, such as LPS

    • FACS-based binding assays using cells expressing recombinant rat TLR4

    • For partial TLR4 constructs, verifying interaction with appropriate binding partners (e.g., MD-2 for extracellular domain)

  • Functional activation testing:

    • NF-κB reporter assays in cells transfected with the recombinant rat TLR4

    • Dose-response curves with known agonists like LPS to confirm proper activation thresholds

    • Inhibition studies with known antagonists to demonstrate specificity

    • Cytokine production assays (e.g., IL-6, IL-8) following stimulation with TLR4 ligands

  • Co-receptor dependency evaluation:

    • Confirming requirement of MD-2 for LPS recognition, as ligands bind the TLR4/MD-2 complex rather than TLR4 alone

    • Verifying functional interaction with other accessory proteins like CD14

  • Comparative analysis with native rat TLR4:

    • Side-by-side comparison with primary rat cells expressing endogenous TLR4

    • Verification that recombinant and native receptors exhibit similar response patterns to various ligands

    • Confirmation that partial agonists like ornithine lipid show consistent effects on both recombinant and native receptors

  • Species-specificity checks:

    • Testing known species-specific ligands to confirm that the recombinant rat TLR4 maintains appropriate species-specific responses

    • Comparing responses to human TLR4 when relevant for translational studies

Proper validation using these approaches ensures that experimental results obtained with recombinant rat TLR4 accurately reflect the biology of this important immune receptor.

How can rat TLR4 models contribute to understanding the role of TLR4 in sterile inflammation?

Rat TLR4 models offer valuable platforms for investigating sterile inflammation, where TLR4 activation occurs in the absence of microbial stimuli:

  • Endogenous ligand recognition:

    • Rat TLR4 recognizes various endogenous damage-associated molecular patterns (DAMPs) released during tissue injury or cellular stress

    • These include heat shock proteins, extracellular matrix components like fibronectin fragments, and fatty acids

    • The EDA domain of fibronectin specifically activates human TLR4 expressed in HEK293 cells (which normally lack TLR4), suggesting similar mechanisms might exist in rat models

  • Liver injury and fibrosis models:

    • Rat models are particularly valuable for studying TLR4's role in liver fibrogenesis, as TLR4 signaling in hepatic stellate cells (HSCs) mediates key fibrogenic responses

    • TLR4 contributes to liver damage from various non-infectious etiologies, including alcoholic and non-alcoholic liver diseases

    • Studies in rats can help clarify how TLR4 activation promotes the inflammatory phenotype and anti-apoptotic properties of HSCs

  • Methodological approaches:

    • Genetic manipulation (knockout or knockdown) of TLR4 in rat models

    • Pharmacological inhibition using selective TLR4 antagonists

    • Administration of specific endogenous DAMPs to isolate their effects

    • Cell type-specific analysis to determine contributions of different TLR4-expressing populations

  • Translational relevance:

    • Single nucleotide polymorphisms of the TLR4 gene affect signal transduction and disease risk in humans, including cirrhosis

    • Rat models can help elucidate how these genetic variations influence sterile inflammatory responses

    • Findings may inform the development of therapeutic strategies targeting TLR4 in human inflammatory conditions

Understanding how rat TLR4 contributes to sterile inflammation provides crucial insights into numerous human diseases characterized by non-infectious inflammatory mechanisms, potentially leading to novel therapeutic approaches.

What are the latest developments in understanding partial agonism of rat TLR4 and its therapeutic implications?

Partial agonism of TLR4 represents an emerging area with significant therapeutic potential. Recent developments in understanding this phenomenon in rat TLR4 include:

  • Molecular characterization of partial agonism:

    • Ornithine Lipid (OL) has been identified as a partial TLR4 agonist that induces approximately half the NF-κB activation achieved by LPS

    • OL exhibits the classic partial agonist property of inhibiting responses to low concentrations of the full agonist (LPS)

    • Increasing LPS concentrations can overcome OL-induced inhibition, confirming competitive binding to the same site on TLR4

  • Dual activity mechanisms:

    • Besides its TLR4 partial agonist activity, OL also activates the NLRP3 inflammasome, creating a unique immunomodulatory profile

    • This dual activity suggests partial TLR4 agonists may have complex effects on inflammation beyond simple TLR4 modulation

  • Structure-activity relationship insights:

    • The carbon chain length of lipid-based TLR4 ligands influences their agonist/antagonist properties

    • Synthetic variants of natural partial agonists can be designed with optimized pharmacological profiles

    • Modifications to the lipid A structure of LPS have yielded partial agonists like monophosphoryl lipid A (MPL), which has been approved as an adjuvant for human vaccines

  • Therapeutic applications:

    • Vaccine adjuvants: Partial TLR4 agonists like MPL preferentially stimulate specific T-helper responses with reduced risk of excessive inflammation

    • Anti-inflammatory approaches: By competing with endogenous TLR4 ligands released during tissue injury, partial agonists may reduce pathological inflammation

    • Liver fibrosis: Targeting TLR4 in hepatic stellate cells represents a promising approach for treating liver fibrosis

  • Experimental tools:

    • Reporter systems like HEK-TLR4 cells with secreted alkaline phosphatase reporters allow precise characterization of partial agonist activity

    • Dose-response curve analysis comparing different ligands can identify partial versus full agonists

These developments provide a foundation for rational design of TLR4-targeting therapeutics with more selective immunomodulatory effects than complete activation or inhibition of the receptor.

How does the interaction between TLR4 and MD-2 in rats differ from other species, and what are the implications for ligand recognition?

The TLR4/MD-2 complex represents the functional unit for ligand recognition, and species-specific differences in this interaction significantly impact experimental outcomes and translational relevance:

  • Structural basis of species specificity:

    • Species-specific LRR variants in TLR4 may result from differences in how MD-2 binds to these regions

    • Lizundia et al. described species-specific restrictions in LPS recognition potentially due to differences in the MD-2 binding to TLR4 LRRs across species

    • These structural variations affect the three-dimensional configuration of the TLR4/MD-2 complex and subsequently influence ligand binding

  • Ligand binding implications:

    • TLR4 ligands appear to bind the TLR4/MD-2 complex rather than TLR4 alone

    • MD-2 partially determines the binding specificity of the TLR4/MD-2 receptor complex for LPS variants

    • These species-specific differences in the TLR4/MD-2 complex affect TLR4 function across animal species

  • Experimental approaches to study these differences:

    • Chimeric receptors combining TLR4 or MD-2 components from different species

    • Site-directed mutagenesis targeting the TLR4-MD-2 interface

    • Structural biology techniques to directly visualize species-specific complex formations

    • Comparative binding studies using surface plasmon resonance or other binding assays

  • Research significance:

    • Special attention to MD-2 activities across species is informative when investigating TLR4 function

    • Understanding species-specific TLR4/MD-2 interactions is crucial for identifying relevant animal models for human disease research

    • These differences may explain variable responses to certain TLR4 ligands across species

  • Translational considerations:

    • The efficacy of TLR4-targeting therapeutics may vary across species due to TLR4/MD-2 interface differences

    • Adjuvants developed using rat models must be carefully evaluated for human application

    • The potential use of synthetic TLR4 agonists as adjuvants for vaccines against poorly immunogenic targets requires consideration of species-specific differences

Understanding these species-specific differences in the TLR4/MD-2 interaction provides essential context for interpreting experimental results and developing therapeutics targeting this important immune receptor complex.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.