Recombinant Rat Torsin-1A-interacting protein 1 (Tor1aip1)

Shipped with Ice Packs
In Stock

Description

Protein Characteristics

TOR1AIP1 is a 583-amino-acid protein (UniProt ID: Q5PQX1) with a molecular weight of ~66 kDa. Key features include:

AttributeDetails
Expression SystemE. coli
TagN-terminal His-tag
Purity>90% (SDS-PAGE validated)
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0
Storage Conditions-20°C/-80°C; avoid freeze-thaw cycles
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL); add glycerol for long-term storage

Source:

Domain Organization

TOR1AIP1 contains a nucleoplasmic N-terminal domain, a single transmembrane (TM) domain, and a lumenal C-terminal domain. It binds to A- and B-type lamins, stabilizing the nuclear envelope architecture .

Key Interactions

  • TorsinA: Induces ATPase activity and localizes torsinA (linked to DYT1 dystonia) to the nuclear membrane .

  • Emerin: Associates with this X-linked Emery-Dreifuss muscular dystrophy protein .

  • Protein Phosphatase 1 (PP1): Dephosphorylates TOR1AIP1, regulating its activity in neuronal maturation .

Note: Alternative splicing in humans generates isoforms (LAP1B, LAP1C), with LAP1C being N-terminally truncated .

Experimental Uses

ApplicationDetails
Western BlotValidated for antibody specificity (e.g., anti-TOR1AIP1 antibodies ab2737, ab317701)
ELISAQuantifies TOR1AIP1 in rat tissues/cell lysates (detection range: 0.156–10 ng/mL)
Antibody ValidationServes as a positive control for immunoprecipitation (IP) and immunofluorescence (IF)

Role in Nuclear Architecture

  • Lamina Assembly: Binds lamins and chromatin, ensuring nuclear envelope stability .

  • Muscular Dystrophy: Conditional deletion in mouse striated muscle causes early lethality, highlighting its muscle-specific role .

Disease Associations

  • DYT1 Dystonia: Mutations in torsinA disrupt its interaction with TOR1AIP1, impairing nuclear membrane function .

  • Limb-Girdle Muscular Dystrophy: Genetic variants (e.g., c.463C>T, c.177C>A) in TOR1AIP1 are linked to autosomal recessive forms .

Mechanistic Studies

  • ER Stress Response: TorsinA overexpression suppresses ER stress markers (e.g., BiP), while its ΔE mutant exacerbates stress sensitivity .

  • Post-Translational Modifications: Phosphorylation and methionine oxidation regulate TOR1AIP1 activity .

Product Specs

Form
Lyophilized powder

Note: We will prioritize shipment of the format currently in stock. If you require a specific format, please specify this in your order notes, and we will fulfill your request to the best of our ability.

Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: All protein shipments include standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

The tag type will be determined during production. If you have a specific tag requirement, please inform us, and we will prioritize its development.

Synonyms
Tor1aip1; Torsin-1A-interacting protein 1; Lamina-associated polypeptide 1B; LAP1B; Lamina-associated polypeptide 1C; LAP1C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-583
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MAGERWRAEGLGEGWAIYVTPRAPIREGRRRLATQNGDGSDAPAYETHPSRHGRREVRFS EEPPEVYGDFEPRAAKERSPGERRTPPEKFRSDSAKEEVRESAYNLRSRQRRQRGPQEAE EMKTRRSTRLEQHSQQAQQQLSPATSGRGLRDAQSLSEDRGEDEPSSQPVTSQTVSKKTV RTPETSVMSEDPISNLCRPPLRSPRPDASIVQHINPFEEGETEDDLESSYSDVTIRIRSR DSVESRDEAAVAAGHHPDSLWGLPHSRGDFTAHENQPSLLPTGCQKNPQEWVEQAVRMRT RMAYNNIQKSDFGNQSPSTSRQQAAVQPPDESSVKIKWWLLILVAALAMGIYWFFHTPVV ETTAVQEFQNQMKQLQSKYQSQDEKLWKRGTTFLEKHLNSSLPRPQPAILLLTAAQDAAE VLKCLSEQIADAYSSFRSVRAIRIDGAGKAAQDSDLVKHEVDQELTDGFRNGQNAAVVHR FESLPAGSTLIFYKYCDHENAAFKDVALVLTVLLEEQTLEASLGLKEIEEKVRDFLKVKF TSSDTANSYNHMDPDKLNGLWSRISHLVLPVQPENALKAGSCL
Uniprot No.

Target Background

Function
Essential for maintaining nuclear membrane integrity. It induces TOR1A and TOR1B ATPase activity and is required for their localization to the nuclear membrane. It binds to A- and B-type lamins and may play a role in membrane attachment and nuclear lamina assembly.
Gene References Into Functions
  1. Studies show that the protein phosphatase 1 (PP1) and nuclear membrane protein lamina-associated polypeptide 1B (LAP1B) LAP1B:PP1 complex can be co-immunoprecipitated from cerebral cortex. PMID: 24116158
Database Links
Protein Families
TOR1AIP family
Subcellular Location
Nucleus inner membrane; Single-pass membrane protein.

Q&A

What is Tor1aip1 and what are its known isoforms in rats?

Tor1aip1, also known as lamina-associated polypeptide 1 (LAP1), is a type II transmembrane protein localized to the inner nuclear membrane. In rat models, three LAP1 isoforms have been reported:

  • LAP1A (approximately 75 kDa)

  • LAP1B (approximately 68 kDa)

  • LAP1C (approximately 55 kDa)

These isoforms result from alternative splicing of the Tor1aip1 pre-mRNA. Rat LAP1B is the only isoform with a RefSeq transcript [GenBank:NM_145092] currently available, while LAP1A and LAP1C have been partially characterized but lack RefSeq entries. There are two non-RefSeq sequences in GenBank related to other isoforms: U20286 (lacking an N-terminal segment) and U19614 (lacking an internal segment) .

What are the primary molecular functions of Tor1aip1?

Tor1aip1 serves several critical functions at the nuclear envelope:

  • It is required for nuclear membrane integrity

  • It induces TOR1A and TOR1B ATPase activity and is necessary for their localization at the nuclear membrane

  • It binds to both A- and B-type lamins

  • It likely plays a role in membrane attachment and assembly of the nuclear lamina

  • It is involved in chromatin binding at the inner nuclear membrane

LAP1 has been linked to various cellular processes, including nuclear envelope structure maintenance and potentially gene expression regulation through its interactions with nuclear lamina components .

How does rat Tor1aip1 differ from human TOR1AIP1?

The key differences between rat and human TOR1AIP1 include:

FeatureRat Tor1aip1Human TOR1AIP1
Isoforms identifiedThree (LAP1A, LAP1B, LAP1C)Two (LAP1B, LAP1C)
Expression patternWidely expressedExpressed in most tissues
Exon structureContains unique exons not found in humanContains some exons not found in rat
Alternative splicingDifferent splicing patternsHas a 3' tandem splice site (TAGCAG) at exon 3 boundary

In rats, the full-length LAP1B isoform is a 506-amino acid protein localized to the inner nuclear membrane. Bioinformatic analysis of human and rat sequences reveals 10 exons in both species, but with different patterns of alternative exon usage that contribute to species-specific isoforms .

What are the recommended methods for expressing recombinant rat Tor1aip1 in experimental systems?

For successful expression of recombinant rat Tor1aip1, consider the following methodological approach:

  • Expression vector selection:

    • Mammalian expression vectors (e.g., pCMV-based) for native post-translational modifications

    • Bacterial systems (pET series) for high yield but lacking mammalian modifications

    • Insect cell systems for balanced yield and post-translational modifications

  • Construct design considerations:

    • Include appropriate tags (His, FLAG, etc.) for purification and detection

    • Consider the transmembrane domain when designing purification strategies

    • For specific isoforms, carefully select primer locations based on the alternative splicing patterns

  • Protein purification approach:

    • Membrane protein extraction using detergents like NP-40 or Triton X-100

    • Affinity chromatography based on incorporated tags

    • Size exclusion chromatography for final purification

When working with the full-length protein, be aware that the transmembrane domain may complicate expression and purification. In such cases, expressing only the nucleoplasmic or lumenal domains may improve yield and solubility .

What antibodies and detection methods are most effective for studying rat Tor1aip1?

Several approaches can be employed for effective detection of rat Tor1aip1:

  • Antibody selection:

    • Polyclonal antibodies generated against residues 175-225 have been successfully used to detect both LAP1B and LAP1C isoforms

    • Recombinant monoclonal antibodies (such as EPR29003-34) have shown specificity for TOR1AIP1 in various applications

    • Custom antibodies targeting unique regions of specific isoforms may be necessary for distinguishing between LAP1A, B, and C

  • Application-specific techniques:

    • Western Blotting: Effective with polyclonal antibodies against residues 175-225

    • Immunofluorescence: Use antibodies validated for ICC/IF applications

    • Dot blotting: Useful for rapid screening, as demonstrated with EPR29003-34 antibody

    • Flow cytometry: Intracellular staining protocols with validated antibodies

  • Controls and validation:

    • Include Tor1aip1 knockdown samples as negative controls

    • Use human samples to compare cross-reactivity

    • Verify specificity by testing for cross-reactivity with TOR1AIP2

When selecting antibodies, consider whether you need to distinguish between isoforms or detect all LAP1 variants collectively .

What are effective strategies for Tor1aip1 gene silencing in rat cell models?

For effective gene silencing of Tor1aip1 in rat cell models, consider these methodological approaches:

  • shRNA-based silencing:

    • Design shRNAs targeting conserved regions between isoforms when aiming to knock down all LAP1 variants

    • Effective target regions include the junction between exon 7 and 8, and sequences within exon 10

    • Clone into appropriate vectors such as pSIREN-RetroQ

    • Transfect using reagents like TurboFect according to manufacturer's protocols

  • siRNA design considerations:

    • Target sequences with minimal off-target effects using prediction algorithms

    • Consider the secondary structure of the mRNA when selecting target sites

    • Use 19-23 nucleotide targets with 3' overhangs

  • Validation of knockdown efficiency:

    • Perform qPCR using primers targeting LAP1 (e.g., 5'-CCGGAACAAGCAGAGTCAAA-3' and 5'-GTGAACAATTCTCAGAACTTGGGAC-3')

    • Verify protein reduction via Western blot

    • Use β-actin or other housekeeping genes as controls

    • Northern blotting with biotinylated probes for transcript analysis

  • CRISPR-Cas9 approaches:

    • Design gRNAs targeting early exons for complete knockout

    • Consider exon-specific targeting for isoform-selective manipulation

Always include appropriate negative controls, such as non-targeting shRNAs or scrambled sequences, and validate knockdown at both mRNA and protein levels .

How do mutations in Tor1aip1 contribute to nuclear envelopathies in experimental models?

Mutations in Tor1aip1 contribute to nuclear envelopathies through several distinct pathological mechanisms:

  • Nuclear envelope structural abnormalities:

    • Loss of LAP1 isoforms results in changes to nuclear envelope morphology

    • Formation of large nuclear-spanning channels containing trapped cytoplasmic organelles

    • Decreased and inefficient cellular motility

    • Reduced anti-lamin nuclear rim staining

  • Molecular interactions disruption:

    • Impaired interaction with TOR1A and TOR1B, affecting their ATPase activity

    • Disturbed binding to A- and B-type lamins

    • Compromised nuclear lamina assembly

    • Potential compensatory increase in emerin (observed in patient fibroblasts)

  • Tissue-specific effects:

    • Differential expression of LAP1 isoforms across tissues explains variable organ involvement

    • Compensatory mechanisms may exist in some tissues but not others

  • Expression changes:

    • Nonsense mutations can lead to nonsense-mediated mRNA decay, reducing mature transcripts

    • Truncated proteins may be subject to rapid degradation

    • Some mutations result in complete absence of both LAP1B and LAP1C

These mechanisms collectively result in cellular dysfunction that manifests as tissue-specific pathology. The severity depends on whether mutations affect one or both major isoforms .

What rat models exist for studying Tor1aip1-associated muscular dystrophy and other diseases?

Several experimental approaches have been employed to model Tor1aip1-associated diseases in rats:

  • Genetic manipulation models:

    • Knockdown models using shRNA targeting specific exons of Tor1aip1

    • CRISPR-Cas9 engineered rat models with mutations mimicking human disease variants

  • Disease-specific phenotypes observed:

    • Muscular dystrophy features including progressive muscle weakness

    • Cardiomyopathy and cardiac conduction defects

    • Neurological manifestations in models affecting both isoforms

  • Comparative disease modeling:

    • Rat models show phenotypic overlap with human Tor1aip1-associated conditions

    • Rat Tor1aip1 models have been validated for autosomal recessive limb-girdle muscular dystrophy type 2Y through isogenic evidence

  • Tissue-specific analyses:

    • Expression pattern studies across tissues show correlation between expression levels and disease manifestation

    • Differential susceptibility of tissues to LAP1 deficiency

These models provide valuable insights into disease mechanisms and potential therapeutic approaches. The rat models have been particularly useful for studying muscular manifestations, though comprehensive models for the full spectrum of human TOR1AIP1-associated diseases are still being developed .

How can proteomics approaches be applied to study the Tor1aip1 interactome in rat tissues?

Comprehensive proteomic analysis of the Tor1aip1 interactome requires sophisticated methodological approaches:

  • Immunoprecipitation-Mass Spectrometry (IP-MS):

    • Use anti-LAP1 antibodies for pull-down experiments from rat tissue lysates

    • Perform cross-linking prior to IP to preserve transient interactions

    • Analyze by LC-MS/MS to identify interaction partners

    • Compare results across different tissues to identify tissue-specific interactions

  • Proximity labeling techniques:

    • BioID approach: Create LAP1-BioID fusion proteins for expression in rat cells

    • APEX2 labeling: LAP1-APEX2 fusions for rapid biotinylation of proximal proteins

    • Analyze biotinylated proteins by MS after streptavidin pull-down

  • Co-fractionation analysis:

    • Separate nuclear envelope fractions from rat tissues

    • Perform protein correlation profiling across fractions

    • Identify proteins that co-fractionate with LAP1 isoforms

  • Validation strategies:

    • Confirm key interactions by reciprocal IP

    • Use yeast two-hybrid or reconstituted complex approaches for direct interaction assessment

    • Employ multiple techniques to overcome the drawbacks of any single method

When interpreting proteomics data, it's crucial to consider that different techniques provide complementary information: two-hybrid and reconstituted complex methods indicate direct interactions, while affinity capture and co-fractionation reveal proteins that may interact indirectly within complexes .

What are the most effective strategies for comparing rat and human TOR1AIP1 function in experimental settings?

To effectively compare rat and human TOR1AIP1 function, consider these methodological approaches:

  • Cross-species complementation studies:

    • Express human TOR1AIP1 in rat cells with Tor1aip1 knockdown/knockout

    • Assess rescue of phenotypes to determine functional conservation

    • Perform domain-swapping experiments to identify species-specific functional regions

  • Genomic and transcriptomic comparative analysis:

    • Use bioinformatic tools like BLAST, NNSPLICE, and GENSCAN to compare genomic structures

    • Analyze alternative splicing patterns between species

    • Identify conserved and divergent regulatory elements

  • Experimental design considerations:

    • Create equivalent mutations in both species' proteins

    • Use consistent cell types or tissues for valid comparisons

    • Control for expression levels when comparing function

  • Specific assays for functional comparison:

    • Nuclear envelope integrity assays

    • Protein-protein interaction studies with common binding partners

    • Subcellular localization analysis

    • ATPase activity assays for TOR1A/TOR1B regulation

  • Comparative protein structure analysis:

    • Use AlphaFold or other structural prediction tools to compare protein structures

    • Analyze the impact of species-specific differences on protein function

Understanding the exon structure differences is crucial for these comparisons. For example, human TOR1AIP1 has 10 exons with potential alternative exons that differ from rat, including putative human exons 1b, 2b, and 3b that may produce additional isoforms .

What advanced imaging techniques are most suitable for studying Tor1aip1 dynamics in the nuclear envelope?

Advanced imaging approaches provide critical insights into Tor1aip1 dynamics at the nuclear envelope:

  • Super-resolution microscopy techniques:

    • Structured Illumination Microscopy (SIM) for ~100 nm resolution

    • Stimulated Emission Depletion (STED) microscopy for ~30-50 nm resolution

    • Single-Molecule Localization Microscopy (SMLM) techniques (PALM/STORM) for ~20 nm resolution

    • Expansion microscopy for physical expansion of samples prior to imaging

  • Live-cell imaging approaches:

    • FRAP (Fluorescence Recovery After Photobleaching) to measure LAP1 mobility

    • Single-particle tracking with photoactivatable fluorescent proteins

    • Lattice light-sheet microscopy for reduced phototoxicity during extended imaging

  • Correlative light and electron microscopy (CLEM):

    • Combine fluorescence imaging with EM for ultrastructural context

    • Immunogold labeling for precise localization at the nuclear envelope

    • Cryo-electron tomography for 3D visualization of protein complexes

  • Proximity labeling visualization:

    • APEX2-mediated DAB precipitation for EM visualization

    • Split-fluorescent protein complementation for direct visualization of interactions

  • Quantitative analysis methods:

    • Colocalization analysis with nuclear lamina markers

    • Tracking of nuclear envelope morphology changes

    • Measurement of nuclear-spanning channels in disease models

These advanced imaging approaches are particularly valuable for studying the nuclear envelope morphology changes observed in cells lacking LAP1 isoforms, including the formation of nuclear-spanning channels containing trapped cytoplasmic organelles .

How might Tor1aip1 contribute to cancer pathogenesis and serve as a biomarker?

Recent research suggests several mechanisms by which Tor1aip1 may contribute to cancer pathogenesis:

  • Expression alterations in cancer:

    • Significant deregulation of TOR1AIP1 expression has been observed across multiple cancer types

    • Particularly notable alterations in kidney renal clear cell carcinoma

    • Expression changes correlate with clinical outcomes in certain cancers

  • Potential mechanistic contributions to cancer:

    • Nuclear envelope integrity disruption affecting genome stability

    • Altered interactions with lamins potentially impacting gene expression

    • Disrupted cellular motility affecting cancer cell migration and invasion

    • Possible roles in cancer-associated cellular senescence

  • Biomarker applications:

    • Expression level analysis for prognostic assessment

    • Correlation with drug sensitivity profiles

    • Potential immunological marker in the tumor microenvironment

  • Methodological approaches for cancer studies:

    • Multi-database expression analysis across cancer types

    • Correlation studies linking expression to clinical outcomes

    • In vitro functional studies in cancer cell lines

    • Validation in animal models and patient-derived samples

The emerging research suggests TOR1AIP1 may serve as both a predictive biomarker for cancer prognosis and a potential therapeutic target, though additional experimental validation is required to fully establish these applications .

What are the current challenges in developing therapies targeting Tor1aip1-associated diseases?

The development of therapies for Tor1aip1-associated diseases faces several significant challenges:

  • Disease mechanism complexity:

    • Different mutations affect different isoforms, creating variable disease phenotypes

    • Multisystem involvement requires targeted approaches for specific tissues

    • Distinguishing primary from secondary effects of LAP1 deficiency

  • Therapeutic delivery challenges:

    • Nuclear envelope targeting is technically difficult

    • Tissue-specific delivery to affected organs (muscle, brain, heart)

    • Crossing the blood-brain barrier for neurological manifestations

  • Potential therapeutic approaches:

    • Gene therapy to restore functional LAP1 expression

    • Antisense oligonucleotides for specific splicing modulation

    • Small molecules targeting compensatory pathways

    • Protein replacement strategies for membrane proteins

  • Clinical development hurdles:

    • Ultra-rare disease status complicates clinical trial design

    • Variability in disease progression even with identical mutations

    • Limited natural history data for most TOR1AIP1-associated conditions

    • Identifying appropriate clinical endpoints for heterogeneous manifestations

  • Methodological gaps:

    • Need for better disease models recapitulating human pathology

    • Improved biomarkers for disease progression and treatment response

    • Better understanding of tissue-specific requirements for LAP1 isoforms

Addressing these challenges will require multidisciplinary approaches combining basic science insights with innovative therapeutic strategies tailored to the specific mechanisms of Tor1aip1-associated pathologies .

How does Tor1aip1 interact with other nuclear envelope proteins to maintain cellular function?

The interactions between Tor1aip1 and other nuclear envelope proteins form a complex network critical for cellular function:

  • Key interaction partners:

    • A- and B-type lamins: LAP1 binds directly to nuclear lamins

    • Torsin family: Induces TOR1A and TOR1B ATPase activity

    • Emerin: Shows compensatory relationship with LAP1

    • Other nuclear envelope proteins in large macromolecular complexes

  • Functional significance of interactions:

    • Nuclear membrane integrity maintenance

    • Nuclear lamina assembly and organization

    • Regulation of nuclear-cytoplasmic transport

    • Mechanical coupling between cytoskeleton and nucleoskeleton

    • Gene expression regulation through chromatin organization

  • Experimental approaches to study interactions:

    • Protein-protein interaction assays (Y2H, co-IP)

    • Proximity labeling methods (BioID, APEX)

    • Live-cell imaging of co-localization

    • Functional rescue experiments

  • Interaction dynamics in disease states:

    • Disrupted interactions in LAP1-deficient cells

    • Compensatory increases in expression of interaction partners

    • Changes in nuclear envelope morphology affecting interaction landscapes

  • Species-specific interaction differences:

    • Conservation of core interactions across species

    • Isoform-specific interactions due to alternative splicing

    • Variations in binding affinity and interaction kinetics

Understanding these interaction networks is essential for developing targeted therapeutic approaches. The synthetic lethality and compensatory interactions observed between emerin and LAP1 in mice suggest potential approaches for therapeutic intervention by targeting parallel pathways .

What are the critical quality control parameters for recombinant rat Tor1aip1 production?

To ensure high-quality recombinant rat Tor1aip1 for research applications, implement these critical quality control parameters:

  • Protein integrity assessment:

    • SDS-PAGE for size verification and purity evaluation

    • Western blotting with isoform-specific antibodies

    • Mass spectrometry for precise molecular weight determination

    • N-terminal sequencing to confirm proper translation initiation

  • Functional verification:

    • Binding assays with known interaction partners (lamins, torsins)

    • ATPase activity induction assays for TOR1A/TOR1B

    • Proper membrane integration in reconstituted systems

  • Structural characterization:

    • Circular dichroism for secondary structure assessment

    • Limited proteolysis to verify proper folding

    • Thermal stability assays

    • Native PAGE for oligomerization state

  • Batch consistency controls:

    • Lot-to-lot comparison using standardized assays

    • Reference standards for activity comparisons

    • Endotoxin testing for cell-based applications

    • Stability testing under various storage conditions

  • Post-translational modification analysis:

    • Phosphorylation status verification (LAP1 is a PP1 substrate)

    • Glycosylation assessment

    • Other modification analyses as appropriate

For transmembrane proteins like LAP1, proper folding and membrane integration are particularly challenging aspects that require careful quality control measures to ensure functional relevance in experimental applications .

How can CRISPR-Cas9 technology be optimized for studying rat Tor1aip1 function?

Optimizing CRISPR-Cas9 approaches for rat Tor1aip1 functional studies requires careful consideration of several technical aspects:

  • Strategic guide RNA design:

    • Target early exons (exons 1-3) for complete knockout

    • Design isoform-specific gRNAs targeting alternative exons

    • Use multiple bioinformatic tools to minimize off-target effects

    • Consider targeting conserved functional domains for specific functional disruptions

  • Delivery method optimization:

    • Lentiviral vectors for stable integration in difficult-to-transfect cells

    • Electroporation for primary rat cells

    • Lipid-based transfection for cell lines

    • RNP complexes for reduced off-target effects

  • Editing strategy selection:

    • Frameshift indels for complete knockout

    • Homology-directed repair for precise mutations or tagging

    • Base editing for specific point mutations

    • Prime editing for precise insertions or deletions without DSBs

  • Validation approaches:

    • T7 endonuclease or Surveyor assays for initial editing efficiency

    • Sanger sequencing of PCR amplicons for edit confirmation

    • Next-generation sequencing for comprehensive editing analysis

    • Western blotting to confirm protein loss or modification

    • qPCR to assess transcript levels

  • Control considerations:

    • Include non-targeting gRNA controls

    • Generate multiple independent clones

    • Rescue experiments with wildtype rat Tor1aip1

    • Off-target analysis of predicted sites

For studying specific disease variants, consider creating isogenic cell lines with precise mutations corresponding to those found in human TOR1AIP1-associated diseases, allowing direct functional comparisons between wildtype and mutant proteins .

What specialized approaches are needed to study embryonic roles of Tor1aip1 in rat models?

Investigating embryonic functions of Tor1aip1 in rat models requires specialized techniques addressing developmental timing and tissue-specific effects:

  • Temporal expression control systems:

    • Inducible knockout systems (Cre-ERT2) for stage-specific deletion

    • Tetracycline-controlled expression systems for reversible manipulation

    • Embryo-specific promoters for targeted expression studies

    • Maternal injection of small molecule inducers for timed activation

  • Embryonic tissue analysis techniques:

    • Whole-mount immunostaining for protein localization

    • In situ hybridization for transcript localization

    • Laser capture microdissection for tissue-specific expression analysis

    • Single-cell RNA-seq for cellular heterogeneity assessment

  • Phenotypic analysis approaches:

    • High-resolution ultrasound for in vivo developmental monitoring

    • Micro-CT for structural analysis

    • Advanced histological techniques for tissue architecture

    • Functional assays specific to developing organs

  • Ex vivo and in vitro developmental models:

    • Whole embryo culture for short-term manipulation

    • Embryonic stem cell differentiation models

    • Organoid systems for tissue-specific development

    • Embryonic tissue explant cultures

  • Specialized genetic approaches:

    • CRISPR-Cas9 embryo injection for germline editing

    • Morpholino knockdown for transient suppression

    • Tissue-specific conditional knockout models

    • BAC transgenesis for physiological expression patterns

These approaches are particularly relevant given the evidence that complete absence of LAP1 isoforms results in severe developmental abnormalities, including growth retardation and multisystem involvement, highlighting the crucial role of Tor1aip1 in early development and organogenesis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.