Recombinant Rat Torsin-1A-interacting protein 2 (Tor1aip2)

Shipped with Ice Packs
In Stock

Description

Overview and Nomenclature

TOR1AIP2 is encoded by the Tor1aip2 gene (Rattus norvegicus) and belongs to the lumenal domain-like LAP1 protein family. It exists in two isoforms:

  • Membrane-bound isoform: A type II integral membrane protein localizing to the endoplasmic reticulum (ER) and nuclear envelope (NE).

  • Interferon-responsive isoform (IFRG15): A cytoplasmic protein induced by interferon-α, though its precise role remains under investigation .

Key identifiers:

AttributeValueSource
RGD ID735059 (Rat Genome Database)
UniProt ID (Human)Q9H496 (Note: Rat-specific UniProt data not explicitly provided)
Molecular Mass (Rat)Predicted: ~28.8 kDa (Recombinant His-tagged variant)

Functional Role in Cellular Biology

TOR1AIP2 regulates TorsinA ATPase activity through direct interaction. Key findings:

Mechanism of Action

TOR1AIP2 binds to TorsinA’s ATP-bound state, inducing ATP hydrolysis. This interaction is disrupted by the DYT1 mutation (ΔE), which causes primary dystonia .

Kinetic Parameters of TorsinA Activation:

ParameterLAP1 (Cofactor)LULL1 (TOR1AIP2)Source
Apparent Kₘ (μM)1.93 ± 0.150.65 ± 0.07
Maximum Velocity (Vₘₐₓ) (μM/min)0.075 ± 0.0070.14 ± 0.005
Turnover Number (min⁻¹)0.160.47

LULL1 (TOR1AIP2) exhibits 3× higher affinity and 3× greater Vₘₐₓ than LAP1, making it a more potent activator .

Subcellular Localization

TOR1AIP2 regulates TorsinA distribution between the ER and NE. Overexpression of WT TorsinA increases ER retention, while mutants (e.g., ΔE) accumulate in the NE .

Research Applications

Recombinant TOR1AIP2 is utilized in:

ApplicationDetailsSource
ELISA AssaysQuantification of endogenous TOR1AIP2 in rat tissues
Immunogen ProductionGenerating anti-TOR1AIP2 antibodies for Western blot (WB)
ATPase Activity StudiesIn vitro reconstitution assays with TorsinA to study dystonia mechanisms
ER Stress ResearchInvestigating TOR1AIP2’s role in suppressing ER stress responses

Interactions with Environmental Toxins

TOR1AIP2 expression is modulated by various chemical agents:

Key Interactions:

Toxin/CompoundEffect on TOR1AIP2 Expression (Rat)Source
2,3,7,8-Tetrachlorodibenzodioxin (TCDD)Decreased mRNA levels (ISO/EXP)
AcrylamideIncreased mRNA expression
Aflatoxin B1Increased mRNA expression; decreased gene methylation
Trichostatin AIncreased mRNA expression (histone deacetylase inhibitor)

Pathological Relevance

Mutations in TOR1AIP2 (human) are linked to early-onset primary dystonia, though rat models remain critical for mechanistic studies. The protein’s role in ERAD (ER-associated degradation) pathways highlights its potential in neurodegenerative disease research .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Tor1aip2; Torsin-1A-interacting protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-578
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Tor1aip2
Target Protein Sequence
MSQTLKSQDTNMSDSGYRDPVEDSQNVLGNDPSVNSQAQDPIVTPSNTVEAQTLHPTSDL KEDHHEIGAKGQEHADTGDRAESSEEPALEKPPLDKAELERSPSSQDTEQRHHPYSEHVG GDTLVLDPNYSQSDLGGRADAHLESSSAAPTEGAGEGGEAGAHLESSCAALPVGADEGGR ANAHLESSSAAPTEGAGEGGEADVHLESSSAVPPEEAHLESSSAAPSEGAGEGGEADAHL ESSSAAPSEGAGEGGETAQNLLAVDSTDAQSPCHSSAGPGSQDSLRRRLPVTEAERHEEE TQLVTEKEEVAQETLRKTEKKSLWTYGSMFLGCLIVAVVLSSVNSYYSSPAQQVPQNPAL EAFLAQFSQLREKFPGQSAFLWQRGRKFLQKHLNASNPSEPATVIFTAAREGKETLKCLS YHVANAYTSSQKVTAVSIDGAERALQDSDTVKLLVDLELSYGFENGHKAAVVHHFESLPA GSTLIFYKYCDHENAAFKDVALVLTVLLEEETLEASVSPRETEEKVRDLLWAKFTDSGTP SSFSHMDSDKLSGLWSRISHLVLPVQPVKNIEERGCLL
Uniprot No.

Target Background

Function
Essential for endoplasmic reticulum integrity. It regulates TOR1A distribution between the endoplasmic reticulum and nuclear envelope and induces ATPase activity in TOR1A, TOR1B, and TOR3A.
Database Links
Protein Families
TOR1AIP family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Nucleus envelope.

Q&A

What is Tor1aip2 and what are its fundamental properties?

Tor1aip2, also known as LULL1 (Luminal domain-Like LAP1), is a transmembrane protein that functions as a major binding partner for TorsinA in the endoplasmic reticulum (ER) . This protein is encoded by the Tor1aip2 gene in rats (Rattus norvegicus) with the UniProt accession number Q6P752 . Structurally, Tor1aip2 consists of 578 amino acids with a predicted molecular weight of approximately 60-70 kDa .

The amino acid sequence of rat Tor1aip2 includes several distinct regions: an N-terminal cytoplasmic domain, a transmembrane segment, and a C-terminal lumenal domain that interacts with TorsinA . The lumenal domain shares significant homology with another TorsinA binding partner, LAP1 (Tor1aip1), despite their different subcellular localizations . This structural similarity suggests an evolutionary relationship between these proteins despite their distinct functions.

Functionally, Tor1aip2 plays a crucial role in regulating TorsinA, an AAA+ (ATPases Associated with diverse cellular Activities) ATPase that is implicated in protein folding, processing, stability, and localization . Through its C-terminal lumenal domain, Tor1aip2 interacts with TorsinA in the ER, potentially influencing its ATPase activity and cellular functions . This interaction appears to be stabilized when certain motifs involved in ATP hydrolysis in TorsinA are mutated .

How does Tor1aip2 interact with TorsinA at the molecular level?

The interaction between Tor1aip2 and TorsinA occurs primarily through the C-terminal lumenal domain of Tor1aip2 . Experimental evidence indicates that this interaction is prominently detected in immunoprecipitation studies using an ATPase-deficient Walker B mutant (E171Q) of TorsinA . This suggests that the binding is part of the normal ATPase cycle of TorsinA, with the substrate-trap mutant stabilizing what may normally be a transient interaction.

Structurally, the binding between Tor1aip2 and TorsinA involves specific regions in both proteins. The C-terminal lumenal domain of Tor1aip2 (approximately residues 236-470) is sufficient for TorsinA binding . This interaction is stabilized when residues in any of three motifs implicated in ATP hydrolysis in TorsinA are mutated: the Walker B motif (E171Q mutation), sensor 1 region (N208A mutation), or sensor 2 region (K320M mutation) .

Importantly, the DYT1 dystonia-associated ΔE deletion in TorsinA (removal of glutamic acid residue 302 or 303) impairs this binding interaction . When this deletion is introduced into TorsinA variants with mutations in ATP hydrolysis motifs, it destabilizes their association with Tor1aip2 . This molecular impairment may contribute to the pathogenesis of DYT1 dystonia by disrupting normal TorsinA function through altered binding to its regulatory partners.

What are the optimal storage conditions for recombinant Rat Tor1aip2?

Recombinant Rat Tor1aip2 requires specific storage conditions to maintain its structural integrity and biological activity for research applications. The protein should be stored in a Tris-based buffer containing 50% glycerol, which has been optimized for this particular protein . This formulation helps prevent freeze-thaw damage and maintains protein stability.

When preparing aliquots for storage, researchers should consider the volume needed for individual experiments to minimize the number of freeze-thaw cycles. Small-volume aliquots in microcentrifuge tubes with minimal air space help maintain protein stability. Additionally, the use of sterile techniques during handling will prevent microbial contamination that could lead to protein degradation.

What are the common applications of recombinant Rat Tor1aip2 in research?

Recombinant Rat Tor1aip2 serves as an essential tool in multiple research contexts, particularly in studies focused on understanding the molecular basis of dystonia and nuclear envelope/endoplasmic reticulum dynamics. One primary application is in enzyme-linked immunosorbent assays (ELISA) for detecting and quantifying Tor1aip2 or its binding partners in experimental samples . This approach allows for sensitive measurement of protein levels in various cellular contexts or disease models.

Protein-protein interaction studies represent another major application. Recombinant Tor1aip2 can be used in pull-down assays, co-immunoprecipitation experiments, and surface plasmon resonance studies to investigate its binding with TorsinA and how this interaction is affected by mutations or cellular conditions . These interaction studies are particularly valuable for understanding how the DYT1 dystonia-associated ΔE deletion in TorsinA affects its binding to Tor1aip2.

Additionally, recombinant Tor1aip2 is employed in structural biology research, including X-ray crystallography and cryo-electron microscopy, to elucidate the three-dimensional structure of the protein and its complexes. The protein can also serve as an antigen for antibody production, enabling the development of specific antibodies for immunohistochemistry, Western blotting, and immunofluorescence applications .

How does the DYT1 dystonia mutation in TorsinA affect its interaction with Tor1aip2?

The DYT1 dystonia mutation is a three-base pair deletion (ΔGAG) in the TOR1A gene that removes one glutamic acid residue (either E302 or E303) from the C-terminal region of TorsinA protein, resulting in the mutant protein known as torsinAΔE . This mutation significantly impairs the binding between TorsinA and its major interaction partners, including Tor1aip2 (LULL1) .

Experimental evidence demonstrates that while normal ATP hydrolysis-deficient mutants of TorsinA (such as E171Q, N208A, or K320M) show enhanced binding to Tor1aip2, introduction of the ΔE deletion into these mutants destabilizes this association . This suggests that the glutamic acid residue removed by the DYT1 mutation plays a critical role in the structural interface between TorsinA and Tor1aip2. Mechanistically, this impaired interaction likely disrupts normal TorsinA function in the endoplasmic reticulum and nuclear envelope.

The functional consequences of this disrupted interaction are profound. Since Tor1aip2 appears to regulate TorsinA's ATPase activity and subcellular localization, impaired binding due to the ΔE mutation may lead to mislocalization of TorsinA, altered ATPase activity, and disrupted protein processing functions . These molecular changes could explain the cellular pathology observed in DYT1 dystonia. Research suggests that this represents a loss-of-function effect, as torsinAΔE cannot rescue the lethality observed in TorsinA knockout mice .

What methodological approaches are most effective for studying Tor1aip2-TorsinA interactions?

Several complementary methodological approaches have proven effective for investigating the interactions between Tor1aip2 and TorsinA. Co-immunoprecipitation (co-IP) combined with mass spectrometry has been particularly successful in identifying Tor1aip2 as a major binding partner of TorsinA . This technique involves expressing tagged versions of TorsinA (such as His6myc-tagged constructs) in cell lines, followed by immunoprecipitation with antibodies against the tag and identification of co-precipitated proteins .

For more detailed analysis of interaction dynamics, researchers have developed ATPase-deficient "substrate trap" mutants of TorsinA (such as E171Q Walker B mutant, N208A sensor 1 mutant, or K320M sensor 2 mutant) . These mutations stabilize the interaction with Tor1aip2, facilitating experimental detection and characterization. This approach has been instrumental in determining how the DYT1 dystonia mutation affects TorsinA's binding properties.

Structural studies using domain mapping experiments have helped delineate the specific regions of both proteins that mediate their interaction. By creating truncation mutants and chimeric constructs of Tor1aip2 and TorsinA, researchers have determined that the C-terminal lumenal domain of Tor1aip2 (residues 236-470) interacts with TorsinA . Additionally, site-directed mutagenesis of specific residues within these domains has helped identify critical amino acids required for the interaction.

What is known about the differential roles of Tor1aip2 versus LAP1 (Tor1aip1) in TorsinA regulation?

Tor1aip2 (LULL1) and LAP1 (Tor1aip1) are related transmembrane proteins that both interact with TorsinA, but they differ in their subcellular localization and likely in their specific regulatory functions . LAP1 is specifically targeted to the inner nuclear membrane of the nuclear envelope, while Tor1aip2 is found in the endoplasmic reticulum . This differential localization is determined by their divergent N-terminal domains, despite the similarity of their C-terminal lumenal domains that interact with TorsinA .

In contrast, Tor1aip2 in the endoplasmic reticulum may regulate TorsinA's role in quality control of protein folding, including increasing clearance of misfolded proteins or holding them in intermediate states for proper refolding . Tor1aip2 may also be involved in TorsinA's functions in cellular trafficking and regulation of multipass membrane proteins such as the dopamine transporter .

How can recombinant Tor1aip2 be used to study protein quality control mechanisms?

Recombinant Tor1aip2 offers a valuable tool for investigating protein quality control mechanisms, particularly those involving TorsinA in the endoplasmic reticulum. TorsinA, in association with Tor1aip2, plays a role in quality control of protein folding by increasing clearance of misfolded proteins or holding them in intermediate states for proper refolding . Research approaches using recombinant Tor1aip2 can help elucidate these mechanisms.

In vitro reconstitution assays represent one powerful methodology. By combining purified recombinant Tor1aip2 with TorsinA and potential substrate proteins in a controlled environment, researchers can directly assess the impact of this interaction on protein folding, aggregation, and degradation. These assays can be coupled with biophysical techniques such as circular dichroism, fluorescence spectroscopy, and light scattering to monitor conformational changes in real-time.

Cell-based assays incorporating recombinant Tor1aip2 can also yield important insights. Researchers can introduce labeled recombinant Tor1aip2 into cells expressing reporter proteins prone to misfolding, such as variants of SGCE (mentioned as a substrate in the search results) . By tracking the fate of these reporter proteins in the presence of wild-type versus mutant Tor1aip2, researchers can determine how Tor1aip2 influences TorsinA's protein quality control functions.

What experimental models are most suitable for investigating Tor1aip2 function in vivo?

Multiple experimental models have been developed to study Tor1aip2 function in vivo, each with specific advantages for addressing different research questions. Rodent models, particularly those involving rats, are valuable because rat Tor1aip2 has been well-characterized and shares significant homology with human Tor1aip2 . Both conventional knockout and conditional knockout mouse models of Tor1aip2 can reveal its physiological roles in different tissues and developmental stages.

Cell culture models using cells derived from different tissues provide systems for studying Tor1aip2 in controlled environments. U2OS cells have been successfully used to study Tor1aip2-TorsinA interactions . Additionally, patient-derived fibroblasts from individuals with DYT1 dystonia offer a disease-relevant cellular context for investigating how the TorsinA ΔE mutation affects its interaction with Tor1aip2 .

RNA interference and CRISPR-Cas9 gene editing technologies enable acute or stable depletion/mutation of Tor1aip2 in various cell types. These approaches allow researchers to examine the immediate and long-term consequences of Tor1aip2 loss on cellular functions, including TorsinA localization, protein quality control, and nuclear envelope morphology. The phenotypes observed can be compared with those seen in cells expressing the DYT1 dystonia-associated TorsinA ΔE mutation.

What are the recommended protocols for expressing and purifying recombinant Rat Tor1aip2?

Efficient expression and purification of recombinant Rat Tor1aip2 requires careful consideration of expression systems, tags, and purification strategies. Based on the available research data, several methodological approaches have shown success. For bacterial expression, the full-length protein may present challenges due to its transmembrane domain, but the soluble lumenal domain (approximately residues 236-470) can be expressed effectively in E. coli systems such as BL21(DE3) .

For expression of full-length Tor1aip2, mammalian expression systems are often preferred to ensure proper folding and post-translational modifications. Human cell lines such as HEK293 or U2OS cells transfected with expression vectors containing Rat Tor1aip2 cDNA have been successfully used . These systems can be optimized using inducible promoters, such as tetracycline-responsive elements, to control expression levels and timing .

Purification typically involves affinity chromatography using tags attached to the recombinant protein. For example, His6-tagged Tor1aip2 can be purified using nickel or cobalt affinity resins, while myc-tagged versions can be immunoprecipitated using anti-myc antibodies . Multi-step purification protocols often yield the best results, combining affinity chromatography with size exclusion chromatography to separate the target protein from contaminants and aggregates.

How can researchers effectively study the membrane topology of Tor1aip2?

Understanding the membrane topology of Tor1aip2 is crucial for characterizing its function in cellular compartments. Several complementary techniques can be employed to map the orientation of different domains relative to the membrane. Protease protection assays represent a classical approach, wherein microsomes containing Tor1aip2 are treated with proteases in the presence or absence of membrane permeabilization. The resulting fragments can be analyzed by immunoblotting with domain-specific antibodies to determine which regions are protected by the membrane.

Fluorescence-based approaches offer powerful visualization of topology. By creating fusion constructs with fluorescent proteins (such as GFP) or epitope tags attached to different domains of Tor1aip2, researchers can use selective membrane permeabilization followed by immunofluorescence microscopy to determine which domains are accessible from which side of the membrane . This approach has helped establish that Tor1aip2 has an N-terminal cytoplasmic domain and a C-terminal lumenal domain separated by a transmembrane segment .

Biochemical fractionation combined with domain-specific antibodies provides another valuable strategy. By separating nuclear, cytosolic, and membrane fractions, then probing with antibodies against different domains of Tor1aip2, researchers can track the localization of specific protein regions. This approach has confirmed that Tor1aip2 localizes predominantly to the endoplasmic reticulum, in contrast to the related LAP1 protein which targets the nuclear envelope .

What analytical techniques are most informative for characterizing Tor1aip2-TorsinA binding kinetics?

Several analytical techniques provide valuable insights into the binding kinetics and thermodynamics of Tor1aip2-TorsinA interactions. Surface plasmon resonance (SPR) represents one of the most powerful approaches, allowing real-time monitoring of association and dissociation between purified recombinant Tor1aip2 (typically the lumenal domain) and TorsinA variants. This technique can determine key parameters such as association rates (kon), dissociation rates (koff), and equilibrium dissociation constants (KD).

Isothermal titration calorimetry (ITC) offers complementary thermodynamic information about the interaction. By measuring heat changes during binding, ITC provides direct determination of binding stoichiometry, enthalpy changes (ΔH), and entropy changes (ΔS), in addition to binding affinity. This approach can reveal the thermodynamic driving forces behind Tor1aip2-TorsinA interaction and how they are affected by mutations like the DYT1 dystonia-associated ΔE deletion.

Microscale thermophoresis (MST) provides another solution-based method for quantifying binding interactions using very small sample volumes. By tracking changes in the movement of fluorescently labeled molecules in microscopic temperature gradients, MST can measure binding affinities under near-native conditions. This technique is particularly valuable for comparative analyses of how different mutations in either Tor1aip2 or TorsinA affect their interaction.

How should researchers interpret conflicting data about Tor1aip2 function across different experimental systems?

Interpreting conflicting data about Tor1aip2 function requires careful consideration of experimental context, including cell type, expression levels, and methodological differences. One common source of discrepancy is the use of overexpression systems versus endogenous protein studies. Overexpression can potentially drive non-physiological interactions or localization patterns that may not reflect normal Tor1aip2 function. Researchers should prioritize validation of findings using endogenous protein detection whenever possible .

Species differences represent another important consideration. While Tor1aip2 is conserved across mammals, subtle differences in sequence or regulation between rat, mouse, and human orthologs might contribute to experimental variability. When comparing across studies, researchers should account for these potential species-specific effects, particularly when translating findings from rodent models to human disease contexts.

The table below summarizes common sources of experimental variability in Tor1aip2 research and suggested approaches for reconciliation:

Source of VariabilityPotential ImpactReconciliation Approach
Overexpression vs. EndogenousArtificial localization or interactionsValidate with endogenous protein studies; use inducible systems with physiological expression levels
Cell Type DifferencesVariation in binding partners or post-translational modificationsCompare results across multiple cell types; prioritize disease-relevant cell types
Full-length vs. Domain ConstructsAltered binding properties or localizationUse both approaches complementarily; validate domain findings with full-length protein
Detection MethodsDifferent sensitivity or specificityEmploy multiple detection methods; validate antibody specificity
Species DifferencesSubtle functional variationsDirect comparison of orthologs in the same experimental system

What are the current limitations in our understanding of Tor1aip2's role in disease pathogenesis?

Despite significant advances, several important limitations remain in our understanding of Tor1aip2's role in disease pathogenesis, particularly in DYT1 dystonia. While we know that the DYT1 dystonia mutation (ΔE) in TorsinA impairs its interaction with Tor1aip2 , the downstream consequences of this impaired interaction for neuronal function remain incompletely characterized. The cell-type specificity of these effects, particularly why certain neurons are more vulnerable despite widespread TorsinA and Tor1aip2 expression, represents a significant knowledge gap.

Another limitation concerns the precise molecular mechanism by which Tor1aip2 regulates TorsinA activity. While Tor1aip2 binds to TorsinA through its lumenal domain , how this binding affects TorsinA's ATPase activity, substrate specificity, or subcellular targeting remains incompletely understood. This mechanistic uncertainty complicates efforts to develop targeted therapeutic approaches for diseases involving TorsinA dysfunction.

The relationship between Tor1aip2 and other TorsinA-interacting proteins, such as LAP1 (Tor1aip1) and nesprin-3 , represents another area requiring further investigation. These proteins may function cooperatively or competitively to regulate TorsinA in different cellular compartments. Understanding these complex interaction networks and how they are disrupted in disease states will require additional research using systems biology approaches and in vivo disease models.

How can researchers address the technical challenges in studying transmembrane proteins like Tor1aip2?

Studying transmembrane proteins like Tor1aip2 presents several technical challenges that require specialized approaches. One major challenge is maintaining protein stability and native conformation during extraction from membranes. Researchers can address this issue by carefully optimizing detergent selection, using mild non-ionic or zwitterionic detergents like CHAPS (as mentioned in the search results) that effectively solubilize membrane proteins while preserving their structure and function.

Expression and purification of recombinant transmembrane proteins often yield low amounts of functional protein. To overcome this limitation, researchers can employ specialized expression systems designed for membrane proteins, such as insect cells (Sf9, High Five) or mammalian cells optimized for membrane protein expression. Alternative approaches include expressing soluble domains separately (such as the lumenal domain of Tor1aip2) or creating fusion constructs with solubility-enhancing partners.

Structural characterization of membrane proteins like Tor1aip2 traditionally presents significant difficulties. Recent advances in cryo-electron microscopy have revolutionized this field, allowing determination of membrane protein structures without the need for crystallization. Additionally, hydrogen-deuterium exchange mass spectrometry provides valuable information about protein dynamics and interaction interfaces while requiring relatively small amounts of protein.

What emerging technologies might advance our understanding of Tor1aip2 function?

Several emerging technologies hold promise for advancing our understanding of Tor1aip2 function in cellular processes and disease contexts. CRISPR-based proximity labeling techniques, such as APEX-mediated biotinylation combined with CRISPR knock-in, allow for identification of proteins that interact with endogenous Tor1aip2 in specific subcellular compartments. This approach can reveal the dynamic interactome of Tor1aip2 under various cellular conditions and in different cell types without the artifacts associated with overexpression.

Advances in high-resolution imaging technologies, including super-resolution microscopy and correlative light and electron microscopy (CLEM), enable visualization of Tor1aip2 localization and dynamics with unprecedented detail. These techniques can reveal the spatial relationships between Tor1aip2, TorsinA, and other components of the endoplasmic reticulum and nuclear envelope at nanometer resolution, providing insights into how these proteins function together in their native environment.

Single-molecule techniques represent another promising direction. Single-molecule FRET (Förster Resonance Energy Transfer) and optical tweezers can directly measure the conformational changes and mechanical properties of Tor1aip2-TorsinA complexes. These approaches may help elucidate how Tor1aip2 binding affects TorsinA's ATPase cycle and how this interaction is disrupted by the DYT1 dystonia mutation.

How might therapeutic strategies targeting the Tor1aip2-TorsinA interaction be developed for dystonia?

Developing therapeutic strategies targeting the Tor1aip2-TorsinA interaction represents a promising approach for treating DYT1 dystonia. Structure-based drug design focused on enhancing the interaction between torsinAΔE and Tor1aip2 could potentially restore normal TorsinA function. This approach would require detailed structural information about the Tor1aip2-TorsinA binding interface and how it is disrupted by the ΔE deletion .

Small molecule stabilizers that act as molecular "glue" to reinforce the weakened interaction between torsinAΔE and Tor1aip2 represent one potential therapeutic strategy. High-throughput screening of compound libraries using assays that measure Tor1aip2-TorsinA binding could identify candidates for further development. Alternatively, peptide-based approaches mimicking critical regions of the binding interface might help compensate for the structural defects caused by the ΔE deletion.

Gene therapy approaches also hold promise. Viral vector-mediated delivery of engineered Tor1aip2 variants with enhanced affinity for torsinAΔE could potentially compensate for the impaired interaction. Similarly, RNA interference strategies targeting the mutant TOR1A allele while preserving wild-type expression could help restore the balance of normal TorsinA function . These approaches could be particularly effective given evidence that removing torsinAΔE can overcome secretory pathway defects in patient-derived fibroblasts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.