Recombinant Rat Trace amine-associated receptor 1 (Taar1)

Shipped with Ice Packs
In Stock

Description

Pharmacological Profile

rTAAR1 is activated by endogenous trace amines (e.g., β-phenethylamine [β-PEA], p-tyramine) and synthetic psychostimulants (e.g., amphetamine, methamphetamine) .

Key Agonist Data:

  • β-PEA: EC₅₀ = 20 nM (rTAAR1) vs. 120 nM (hTAAR1) .

  • (±)-Amphetamine: EC₅₀ = 1.2 μM (rTAAR1); d-isomer shows 5x higher potency than l-isomer .

  • MDMA: EC₅₀ = 3.4 μM (rTAAR1) .

Co-expression with monoamine transporters (e.g., dopamine transporter, DAT) enhances rTAAR1 signaling by facilitating intracellular substrate entry .

Functional Role in Monoamine Regulation

rTAAR1 modulates dopaminergic signaling through two mechanisms:

  1. Transporter internalization: Activation triggers protein kinase A (PKA) and protein kinase C (PKC)-mediated phosphorylation of DAT, reducing reuptake capacity .

  2. Neuronal firing suppression: TAAR1 agonists hyperpolarize dopaminergic neurons via GIRK channels, limiting dopamine release .

Table 2: Functional Effects of rTAAR1 Activation

ProcessOutcomeExperimental Model
DAT phosphorylationReduced dopamine uptakeHEK293 co-transfection
Methamphetamine responseAttenuated hyperlocomotionTaar1 knockout mice
Amphetamine-induced CTAEnhanced aversion sensitivityMAHDR/MALDR mouse lines

Species-Specific Pharmacology

rTAAR1 exhibits distinct ligand selectivity compared to mouse and human orthologues:

  • Stereoselectivity: Rat TAAR1 shows stronger activation by d-amphetamine than mouse TAAR1 .

  • Mutagenesis studies: Substituting rat-specific residues (e.g., M6.55T) reduces amphetamine potency by 50% .

Research Applications

Recombinant rTAAR1 is utilized in:

  • High-throughput screening for addiction therapeutics .

  • Mechanistic studies of psychostimulant action .

  • Behavioral models: Taar1 knockout mice exhibit increased methamphetamine consumption and reduced aversion .

Key Research Findings

  1. Amphetamine synergy: rTAAR1 activation synergizes with monoamine transporter inhibition to amplify dopamine efflux .

  2. Genetic linkage: A Taar1 null allele in DBA/2J mice correlates with high methamphetamine preference .

  3. Immune interactions: rTAAR1 regulates chemotaxis in leukocytes, though this is less characterized than CNS roles .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format preference, please indicate your requirement in the order notes. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us and we will prioritize its development.
Synonyms
Taar1; Ta1; Tar1; Trar1; Trace amine-associated receptor 1; TaR-1; Trace amine receptor 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-332
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MHLCHNSANISHTNSNWSRDVRASLYSLISLIILTTLVGNLIVIISISHFKQLHTPTNWL LHSMAVVDFLLGCLVMPYSMVRTVEHCWYFGELFCKLHTSTDIMLSSASILHLAFISIDR YYAVCDPLRYKAKINLAAIFVMILISWSLPAVFAFGMIFLELNLEGVEELYHNQVFCLRG CFPFFSKVSGVLAFMTSFYIPGSVMLFVYYRIYFIAKGQARSINRANLQVGLEGESRAPQ SKETKAAKTLGIMVGVFLLCWCPFFFCMVLDPFLGYVIPPTLNDTLNWFGYLNSAFNPMV YAFFYPWFRRALKMVLFGKIFQKDSSRSKLFL
Uniprot No.

Target Background

Function
Trace amine-associated receptor 1 (TAAR1) is a receptor for trace amines, including beta-phenylethylamine (b-PEA), p-tyramine (p-TYR), octopamine, and tryptamine. It exhibits the highest affinity for b-PEA and p-TYR. TAAR1 is unresponsive to classical biogenic amines, such as epinephrine and histamine, and only partially activated by dopamine and serotonin. Trace amines are biogenic amines present in very low levels in mammalian tissues. While some trace amines have established roles as neurotransmitters in invertebrates, their exact function as neurotransmitters in vertebrates remains under investigation. Trace amines are likely involved in various physiological processes that are yet to be fully understood. The signaling pathway activated by this receptor involves the G(s)-class of G-proteins, which stimulate adenylate cyclase.
Gene References Into Functions
  1. Pretreatment with the TAAR1 antagonist EPPTB (5mg/kg, i.v.) blocked the inhibitory effect of LSD on VTA DA neurons. PMID: 27544651
  2. TAAR1 in different subregions of the mesocorticolimbic system contributes to the reinstatement of cocaine-seeking behavior. PMID: 28123023
  3. Results demonstrate that betaArr2 signaling may be a crucial pathway for TAAR1 function. Activation of the TAAR1-D2R complex negatively modulates GSK3b signaling PMID: 26372541
  4. The differential functionality of rat Taar subtypes 1 and 4 primarily correlates with receptor's cell surface expression rather than with specific amino acid residues involved in ligand binding specificity. PMID: 23072560
  5. Data indicate that TAARs were expressed only in trace amounts in most tissues. Exceptions include TAAR1 in stomach and testis, and TAAR8a in intestine, spleen, and testis. PMID: 22442117
  6. This overview focuses on recent studies highlighting the role of TAAR1 in the functional regulation of monoamine transporters and the neuronal regulatory mechanisms that modulate dopaminergic activity. [review] PMID: 21073468
  7. Tyramine is highly concentrated in the median eminence of the mediobasal hypothalamus, where its physiological function on prolactin release has been demonstrated. PMID: 15955414

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Widely distributed, but in low abundance, throughout the brain. Highest levels detected in the olfactory bulb, nucleus accumbens/olfactory tubercle, prefrontal cortex and other cortical regions, midbrain regions consisting of substantia nigra and ventral

Q&A

What is Trace amine-associated receptor 1 (Taar1) and what is its significance in neuropharmacology?

Trace amine-associated receptor 1 (TAAR1) is a G protein-coupled receptor selectively activated by trace amines. It exhibits broad expression throughout the monoaminergic system in the brain, including ventral tegmental area (VTA), nucleus accumbens (NAc), dorsal raphe (DR), and substantia nigra (SN). TAAR1 plays a crucial role in modulating the monoaminergic system, particularly dopamine transmission, which underlies its significance in drug abuse mechanisms . Recent research has positioned TAAR1 as a novel pharmacological target for treating schizophrenia and other neuropsychiatric conditions . The receptor's ability to inhibit rewarding and reinforcing effects of various drugs, including psychostimulants, opioids, and alcohol, makes it particularly relevant for addiction research .

How does rat Taar1 (rTAAR1) differ from mouse and human orthologs?

Rat TAAR1 shares high sequence similarity with mouse and human orthologs, yet demonstrates significant species-specific pharmacological differences. These differences are particularly evident in ligand potency profiles. For instance, 3-Iodothyronamine (T1AM) is approximately 10-fold more potent at rat TAAR1 than at mouse TAAR1 (mTAAR1) and over 15-fold more potent than at human TAAR1 (hTAAR1) . These interspecies variations extend to numerous other endogenous and exogenous TAAR1 agonists . Molecular determinants underlying these species-specific differences include several non-conserved residues that contribute to the potency variations of TAAR1 agonists between species .

What are the key challenges in expressing functional recombinant rat Taar1 in cellular systems?

Recombinant expression of rat TAAR1 presents several technical challenges that researchers must overcome:

  • Predominantly intracellular expression with inadequate membrane localization

  • Insufficient expression levels for robust pharmacological profiling

  • Species-specific differences in receptor function despite sequence similarity

  • Post-translational modification requirements that may vary between expression systems

While these challenges are documented for human TAAR1 (which lacks asparagine-linked N-glycosylation critical for membrane expression and stability), similar issues affect rat TAAR1 expression . To improve functional expression, researchers have employed strategies such as adding N-terminal peptide sequences from other GPCRs to enhance membrane trafficking. For instance, adding the first nine amino acids of the human β2-adrenergic receptor has been shown to improve membrane expression for human TAAR1, and similar approaches may benefit rat TAAR1 expression .

Which expression systems are most effective for recombinant rat Taar1 studies?

Based on existing research protocols, insect cell expression systems have demonstrated effectiveness for recombinant TAAR1 studies. For structural and functional characterization, engineered TAAR1 constructs have been successfully coexpressed in insect cells with human Gαs, Gβ1, and Gγ2 . For rat TAAR1 specifically, mammalian expression systems such as HEK293T cells can be used with appropriate modifications to address trafficking issues.

When selecting an expression system, researchers should consider:

  • The need for mammalian post-translational modifications

  • Expression level requirements for intended assays

  • Compatibility with planned signaling readouts (cAMP accumulation is commonly used)

  • Whether structural or functional studies are the primary objective

Each system should be optimized for rat TAAR1 expression by addressing species-specific challenges in receptor trafficking and stability.

Which key residues are critical for rat Taar1 ligand binding and function?

Several residues have been identified as critical for TAAR1 ligand binding and function through mutational and structural studies. While not all data is specific to rat TAAR1, comparative studies provide insights into conserved functional residues:

The aspartic acid residue at position 103 (D103^3.32) is crucial for agonist binding, as substitution to asparagine (D103^3.32N) abolishes responses to all ligands . The tryptophan residue at position 264 (W264^6.48) is also essential, as the W264^6.48F substitution significantly reduces agonist potency .

Other important residues in the binding site include:

  • D112^3.32, F267^6.51, F268^6.52, and Y294^7.43 (conserved across aminergic GPCRs)

  • Species-specific residues that affect ligand potency (positions equivalent to human V184^ECL2, T194^5.42, I290^7.39)

For rat TAAR1 specifically, the residue N290^7.39 (equivalent to I290^7.39 in human TAAR1) significantly influences the potency of certain agonists, particularly ulotaront and T1AM .

How do species-specific amino acid variations affect ligand potency at rat Taar1?

Species-specific amino acid variations substantially impact ligand potency at TAAR1 receptors. Comparative studies between rat, mouse, and human TAAR1 have revealed the following effects:

  • The substitution at position 290^7.39 (I290^7.39 in human vs. N290^7.39 in rat) increases potency for certain agonists like ulotaront and T1AM at rat TAAR1, without affecting the potency of other agonists such as PEA .

  • The residue at position 194^5.42 (T194^5.42 in human vs. A194^5.42 in rat/mouse) influences agonist potency in a ligand-dependent manner .

  • The residue at position 184^ECL2 (V184^ECL2 in human vs. P184^ECL2 in rat/mouse) affects binding pocket conformation and agonist interactions .

These single amino acid differences can produce large effects on agonist activity between species, highlighting the importance of species-specific characterization when developing TAAR1-targeted compounds .

What are the most reliable assays for measuring rat Taar1 activation in recombinant systems?

For measuring rat TAAR1 activation in recombinant systems, cAMP accumulation assays are widely used and reliable. TAAR1 couples primarily to Gαs, activating adenylyl cyclase and increasing intracellular cAMP levels upon agonist binding. The following approaches are recommended:

  • cAMP accumulation assays: These detect changes in intracellular cAMP levels following receptor activation and can utilize various detection methods:

    • ELISA-based cAMP detection kits

    • FRET or BRET-based biosensors for real-time monitoring

    • Glosensor or similar luminescence-based cAMP detection systems

  • Signaling pathway analysis: Beyond cAMP, examining downstream effects on PKA, CREB phosphorylation, or gene expression can provide complementary information about receptor function.

  • Receptor internalization assays: Using fluorescently-tagged receptors to monitor trafficking following agonist exposure.

When designing these assays, researchers should include appropriate positive controls such as known TAAR1 agonists (e.g., T1AM, which shows high potency at rat TAAR1) and negative controls .

How should researchers design mutations to study structure-function relationships in rat Taar1?

When designing mutations to study structure-function relationships in rat TAAR1, researchers should consider:

  • Targeted approach based on sequence alignment: Identify conserved residues across aminergic GPCRs and unique residues in rat TAAR1 through multiple sequence alignment with other species' TAAR1 and related receptors.

  • Site-directed mutagenesis strategies:

    • Alanine scanning of suspected binding pocket residues

    • Conservative vs. non-conservative substitutions to probe specific interactions

    • Reciprocal mutations between species (rat to human or mouse) to identify species-specific determinants

  • Functional residue categories to target:

    • Orthosteric binding site residues (e.g., D103^3.32, W264^6.48)

    • Residues involved in G-protein coupling

    • Residues affecting receptor expression and trafficking

    • Species-variant positions (e.g., position 290^7.39, which is asparagine in rat vs. isoleucine in human)

  • Analysis methods:

    • Compare EC50 values for various agonists across mutants

    • Assess changes in basal activity

    • Measure receptor expression levels to account for expression differences

A systematic approach is exemplified by previous studies that substituted specific residues from other species' TAAR1 into human TAAR1, revealing their influence on agonist potency in a ligand-dependent manner .

What are the known functional consequences of Taar1 genetic variations in rodent models?

Genetic variations in Taar1 have significant functional consequences in rodent models, particularly regarding drug responses and addiction-related behaviors:

The most well-characterized variant is the Taar1^m1J allele, which contains a SNP at position 229 that encodes a missense proline (CCC) to threonine (ACC) mutation in the second transmembrane domain . This mutation eliminates TAAR1 function . Studies have demonstrated several phenotypic consequences associated with this non-functional variant:

  • Increased methamphetamine intake: Mice homozygous for the Taar1^m1J allele consume significantly higher amounts of methamphetamine compared to those with functional TAAR1 .

  • Reduced methamphetamine-induced conditioned taste aversion: The Taar1^m1J genotype is associated with decreased aversive effects of methamphetamine .

  • Reduced methamphetamine-induced hypothermia: Mice with the non-functional variant show attenuated hypothermic responses to methamphetamine administration .

  • Altered dopaminergic signaling: The mutation affects TAAR1's normal regulation of dopamine transmission, potentially underlying the changes in drug-related behaviors .

CRISPR-Cas9 gene editing to replace the non-functional variant with a working version resulted in decreased methamphetamine consumption and restored sensitivity to methamphetamine-induced hypothermia, confirming the causal role of Taar1 in these phenotypes .

How do Taar1 genotypes interact with other genes to affect behavioral and physiological responses?

Taar1 genotypes interact with other genes to modulate behavioral and physiological responses, revealing complex genetic networks underlying addiction-related phenotypes. Studies have specifically examined interactions between Taar1 and Oprm1 (μ-opioid receptor gene):

The effects of Taar1 on both methamphetamine consumption and methamphetamine-induced hypothermia depend on Oprm1 genotype, indicating significant gene-gene interactions in addiction pathways . This demonstrates that TAAR1's influence on drug responses operates within a broader genetic context.

The study of gene-gene interactions involving Taar1 has important implications:

  • It suggests multiple mechanistic pathways through which TAAR1 modulates drug effects

  • It highlights the importance of considering genetic background when studying Taar1 function

  • It provides insights into individual differences in vulnerability to substance use disorders

  • It may inform personalized approaches to addiction treatment based on genetic profiles

Researchers investigating Taar1 should consider potential interactions with genes encoding other monoamine receptors, transporters, and metabolic enzymes that participate in overlapping signaling pathways.

How can researchers effectively engineer recombinant rat Taar1 for improved structural studies?

Engineering recombinant rat TAAR1 for structural studies requires addressing several challenges to improve expression, stability, and crystallization properties. Based on successful approaches with TAAR1 from other species, researchers should consider:

  • N-terminal modifications:

    • Adding the first nine amino acids of the human β2-adrenergic receptor to improve membrane expression

    • Incorporating signal peptides optimized for the chosen expression system

  • Fusion protein strategies:

    • Adding stabilizing fusion partners such as BRIL (apocytochrome b562 fusion protein) as demonstrated in previous TAAR1 structural studies

    • Positioning the fusion partner to minimize interference with ligand binding

  • Targeted mutations:

    • Introducing specific mutations that enhance receptor stability without affecting ligand binding properties

    • For example, mutations analogous to F112^3.41W and H63^2.44V used in previous TAAR1 studies

  • C-terminal modifications:

    • Strategic truncation (e.g., removing eight amino acids at the C-terminus) to enhance stability

    • Addition of purification tags positioned to minimize interference with receptor function

  • Expression system selection:

    • Insect cell systems have been successfully used for TAAR1 structural studies

    • Mammalian expression systems with optimized growth conditions for rat TAAR1

These engineering approaches should be validated through functional assays to ensure that the modified receptor maintains appropriate ligand binding and signaling properties while achieving the improved expression and stability needed for structural studies.

What are the methodological considerations for designing TAAR1 agonists with species selectivity?

Designing TAAR1 agonists with species selectivity requires a systematic approach informed by structural differences between rat, mouse, and human TAAR1. Key methodological considerations include:

  • Homology modeling and molecular dynamics:

    • Construct species-specific homology models using appropriate templates

    • Previous successful approaches used β2-adrenoreceptor structures as templates (PDB IDs: 3PDS, 2RH1, 3SN6)

    • Evaluate model quality through Ramachandran plots and other validation metrics

    • Use molecular dynamics simulations to refine models and account for binding site flexibility

  • Virtual screening strategies:

    • Employ both ligand-based and structure-based approaches

    • Consider using multiple receptor conformations to distinguish between agonists and antagonists

    • Implement docking protocols with genetic algorithms for pose optimization (e.g., MOE-Dock)

  • Focus on species-specific residues:

    • Target ligand interactions with identified species-variant positions:

      • Position 290^7.39 (I in human vs. N in rat)

      • Position 194^5.42 (T in human vs. A in rat/mouse)

      • Position 184^ECL2 (V in human vs. P in rat/mouse)

    • Design compounds that exploit these differences for selective binding

  • Iterative optimization:

    • Test initial candidates with diverse functional groups

    • Systematically modify structures based on structure-activity relationships

    • Employ computational tools to predict species-specific activity before synthesis

This approach has been successfully implemented in the development of compounds with differential activity across TAAR1 orthologs, demonstrating the feasibility of achieving species selectivity .

How should researchers address species differences when translating rat Taar1 findings to human applications?

When translating rat TAAR1 research findings to human applications, researchers must systematically address species differences through the following approaches:

  • Comparative pharmacology assessment:

    • Test key compounds across rat, mouse, and human TAAR1 recombinant systems under identical conditions

    • Generate comprehensive potency (EC50) and efficacy (Emax) profiles

    • Create correlation matrices to identify compounds with consistent cross-species activity profiles

  • Structure-activity relationship (SAR) analysis:

    • Identify structural features that confer species selectivity

    • Determine if modifications can broaden activity across species

    • Develop predictive models for species-specific activity

  • In vitro to in vivo translation:

    • Consider species differences in TAAR1 distribution and expression levels

    • Account for potential differences in downstream signaling pathways

    • Evaluate compensatory mechanisms present in one species but not others

  • Key residue considerations:

    • Focus on the functional consequences of species-specific residues

    • For example, position 290^7.39 (I290 in human vs. N290 in rat) significantly impacts agonist potency in a compound-specific manner

    • Develop compounds that interact with conserved residues when cross-species activity is desired

  • Complementary approaches:

    • Use humanized rodent models when available

    • Implement translational biomarkers that function similarly across species

    • Consider computational approaches to predict human responses based on rodent data

These systematic approaches can help mitigate the risk of false positives or negatives when extrapolating from rat to human TAAR1 pharmacology.

What are the most common technical pitfalls in rat Taar1 recombinant expression studies and how can they be overcome?

Recombinant expression studies with rat TAAR1 encounter several technical challenges that can impact experimental outcomes. The following table outlines common pitfalls and recommended solutions:

Technical PitfallManifestationSolution Strategies
Poor membrane expressionLow signal-to-noise ratio in functional assays- Add N-terminal tags from β2-adrenergic receptor
- Optimize codon usage for expression system
- Include molecular chaperones to aid folding
High constitutive activityElevated baseline signaling, narrow assay window- Use partial agonists as reference compounds
- Employ inverse agonist controls
- Normalize data to account for baseline shifts
Species-specific pharmacologyUnexpected potency shifts compared to literature- Always include reference compounds tested in the same system
- Verify the species origin of your TAAR1 construct
- Create species-specific positive controls
Post-translational modification variationsInconsistent glycosylation affecting function- Consider using mammalian expression systems
- Characterize glycosylation state of the receptor
- Test multiple cell lines to identify optimal expression
G-protein coupling efficiencyVariable signal amplification- Co-express appropriate G-proteins (Gαs)
- Consider chimeric G-proteins for enhanced coupling
- Use multiple assay readouts (cAMP, GTPγS binding)
Receptor degradationDeclining expression over time- Optimize culture conditions and timing
- Use proteasome inhibitors judiciously
- Consider inducible expression systems

Additional technical considerations include:

  • Assay timing optimization: TAAR1 signaling may have distinct temporal profiles compared to other GPCRs.

  • Temperature sensitivity: Consider that temperature affects both expression and function, particularly relevant for hypothermia-inducing compounds like methamphetamine .

  • Reference compound selection: Use compounds with established activity at rat TAAR1 specifically, such as T1AM, which shows higher potency at rat TAAR1 than at human TAAR1 .

By systematically addressing these pitfalls, researchers can improve the reliability and reproducibility of rat TAAR1 recombinant expression studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.