Recombinant Rat Trace amine-associated receptor 2 (Taar2)

Shipped with Ice Packs
In Stock

Description

Definition and Molecular Characterization

Recombinant Rat Trace Amine-Associated Receptor 2 (Taar2) is a genetically engineered form of the rat TAAR2 receptor, a G protein-coupled receptor (GPCR) involved in modulating neurotransmitter systems and olfactory signaling. TAAR2 belongs to the trace amine-associated receptor (TAAR) family, which detects biogenic amines structurally related to classical monoamines like dopamine and serotonin .

Key molecular features:

  • Gene ID: 209512 (MGI:2685071) .

  • Protein structure: Predicted 7-transmembrane domain topology typical of GPCRs .

  • Expression systems: Recombinant TAAR2 is typically expressed in heterologous systems (e.g., E. coli or mammalian cells) for functional studies .

Biological Role and Functional Insights

TAAR2 regulates dopamine signaling, neuronal activity, and adult neurogenesis in limbic brain regions (e.g., hippocampus, striatum) . Knockout (KO) studies in rats/mice reveal:

ParameterTAAR2-KO PhenotypeMechanistic Insight
Dopamine levels↑ Striatal dopamineReduced MAO-B mRNA; ↑ dopaminergic neurons
Neurogenesis↑ Proliferating cells in SVZ/SGZBDNF upregulation in striatum
Electrophysiology↓ Cortical/striatal spectral powerAltered neuronal network oscillations
Behavior↑ Locomotor activity; ↓ depressionDopaminergic hyperactivity

Data derived from KO mouse models .

Recombinant TAAR2 Applications in Research

Recombinant TAAR2 is critical for:

  • Ligand screening: Identifying endogenous or synthetic agonists/antagonists .

  • Structural studies: Mapping binding pockets using cryo-EM or X-ray crystallography .

  • Signaling pathway analysis: Coupling to Gα<sub>olf</sub> or other G-proteins .

Technical challenges:

  • Low endogenous expression necessitates recombinant overexpression .

  • Lack of confirmed endogenous ligands complicates functional assays .

Current Research Findings

  • Expression profiling: TAAR2 is detected in rat olfactory bulb, hippocampus, and habenula via β-galactosidase staining .

  • Neurochemical alterations: Elevated BDNF and MAO-B mRNA in TAAR2-KO striatum correlate with increased neurogenesis .

  • Species-specific divergence: Rat TAAR2 shares 85% sequence homology with mouse TAAR2 but differs in ligand-binding regions .

Future Directions

  • Ligand discovery: High-throughput screening using recombinant TAAR2 .

  • Therapeutic targeting: Potential for modulating dopamine-related disorders (e.g., Parkinson’s, depression) .

  • Comparative studies: Contrasting rodent TAAR2 with human TAAR2 (expressed in leukocytes and testes) .

Critical Knowledge Gaps:

  • Endogenous ligands for TAAR2 remain unidentified .

  • Limited structural data on recombinant rat TAAR2 .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you require a specific format, please indicate your preference in the order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference for your use.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Taar2; Gpr58; Trace amine-associated receptor 2; TaR-2; Trace amine receptor 2; G-protein coupled receptor 58
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-339
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MTSFEAQQETFDCSEYGNGSCPENERSLGVRAAMYSLMAGAIFITIFGNLVMIISISYFK QLHTPTNLLILSMAVTDFLLGFTIMPYSMVRSVENCWYFGLTFCKIHYSFDLMLSITSIF HLCSVAIDRFYAICHPLHYCTKMTIPVVKRLLLVCWSVPGAFAFGVVFSEAYADGIEGYD ILVACSSSCPVMFNKLWGTTLFVAGFFTPSSMMVGIYGKIFAVSKKHARVIDNLPENQNN QMRKDKKAAKTLGIVMGVFLLCWFPCFFTILLDPFLNFSTPAILFDALTWFGYFNSTCNP LIYGFFYPWFRRALRYILLGKIFSSHFHNTNLFTQKETE
Uniprot No.

Target Background

Function
Orphan receptor.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the expression pattern of Taar2 in the rat brain?

Taar2 shows expression in multiple brain regions beyond the olfactory system. Studies using LacZ histochemistry in knockout models have revealed Taar2 expression in the hippocampus, cerebellum, cortex, raphe nuclei, hypothalamus, and habenula . This widespread distribution suggests that Taar2 plays roles beyond olfactory functions, potentially influencing limbic system activities. Researchers should consider these diverse expression sites when designing experiments to investigate Taar2 functions.

How does rat Taar2 differ from other TAAR family members?

While all TAARs share structural similarities as G protein-coupled receptors, Taar2 appears to have distinct functional properties. Unlike TAAR1, which has well-established roles in modulating monoaminergic neurotransmission, Taar2's functions are still being elucidated. The structure of Taar2 predicts high affinity to primary amines, distinguishing it from other family members . Additionally, Taar2 shows expression patterns that overlap with but differ from those of TAAR5, which has been found in amygdala, hippocampus, piriform cortex, and thalamic and hypothalamic nuclei .

What potential physiological roles does Taar2 play in the brain?

Based on knockout studies, Taar2 appears involved in regulating dopamine levels, neuronal electrophysiological activity, and adult neurogenesis. TAAR2-KO mice demonstrate increased locomotor activity, less immobility in the forced swim test, elevated striatal dopamine levels, and increased dopaminergic neuron numbers in the substantia nigra . Furthermore, Taar2's expression in the dorsal raphe suggests potential involvement in serotonergic neurotransmission and mood regulation . The receptor's presence in hypothalamic and thalamic regions indicates possible roles in sleep/wake regulation and circadian rhythms .

What expression systems are optimal for producing functional recombinant rat Taar2?

For recombinant expression of rat Taar2, mammalian expression systems are generally preferred over bacterial or insect cell systems due to the need for proper post-translational modifications. HEK293 cells are commonly used for TAAR expression studies. When designing expression vectors, consider including N-terminal signal sequences to improve membrane targeting and C-terminal epitope tags (such as FLAG or His-tag) for detection and purification. Co-expression with chaperone proteins may enhance functional expression levels.

How can I verify successful expression of recombinant rat Taar2?

Verification requires a multi-faceted approach:

  • mRNA expression: Use qPCR with specific primers (similar to those used for mouse TAAR2: mTAAR2_F: 5′-CGGATTCACCATCATGCCAT-3′, mTAAR2_R: 5′-CTAAGCATCAGGTCGAAGCT-3′) . Design rat-specific primers if working with rat Taar2.

  • Protein expression: Western blotting with antibodies against the receptor or epitope tags.

  • Subcellular localization: Immunocytochemistry or confocal microscopy to confirm membrane localization.

  • Functional assays: cAMP accumulation or calcium mobilization assays to verify receptor functionality.

What are the best methodologies for genotyping Taar2 in experimental rat models?

For genotyping Taar2 in rat models, PCR-based methods are most reliable. Design primers that span unique regions of the Taar2 gene. If working with knockout models, a strategy similar to that used for mouse models can be adapted, using primers that detect both the wild-type gene and the knockout construct . For example, in mouse models, a four-primer PCR approach has been effective for differentiating between wild-type, heterozygous, and homozygous knockout animals by identifying characteristic fragment lengths (200 bp for wild-type, 400 bp for knockout) .

What signaling pathways are activated by rat Taar2, and how can they be measured?

While the specific signaling pathways of rat Taar2 remain under investigation, based on other TAAR family members, Taar2 likely couples to G proteins that modulate cAMP levels. Researchers should consider the following approaches to characterize signaling:

  • cAMP assays: Use ELISA-based methods or reporter gene assays (e.g., CRE-luciferase) to measure changes in cAMP levels following receptor activation.

  • Calcium mobilization: Utilize fluorescent calcium indicators to detect potential Gq-mediated calcium responses.

  • Protein phosphorylation: Assess phosphorylation of downstream effectors such as CREB or ERK using Western blotting with phospho-specific antibodies.

  • Transcriptional changes: Analyze alterations in gene expression patterns, particularly those involving monoamine metabolism, such as MAO-B and BDNF, which have shown changes in Taar2-KO mice .

How can I identify and validate potential ligands for recombinant rat Taar2?

Ligand identification for rat Taar2 remains challenging due to limited selective compounds. A systematic approach includes:

  • In silico screening: Computational modeling based on the predicted structure of Taar2, focusing on primary amines as potential ligands .

  • High-throughput screening: Test libraries of small molecules using functional assays such as cAMP accumulation or receptor internalization.

  • Binding assays: Develop radioligand binding assays once a high-affinity ligand is identified.

  • Validation: Confirm specificity by comparing responses in cells expressing Taar2 versus control cells and by testing candidates against other TAAR subtypes.

  • Structure-activity relationship studies: Once initial hits are identified, synthesize derivatives to improve potency and selectivity.

What electrophysiological approaches are useful for studying Taar2 function in neural circuits?

Given that TAAR2-KO mice show alterations in brain electrophysiological activity, particularly decreased spectral power in the cortex and striatum , several electrophysiological approaches can be valuable:

  • In vivo recordings: Multi-electrode arrays to record local field potentials and single-unit activity in regions expressing Taar2.

  • Ex vivo slice recordings: Patch-clamp recordings in brain slices from regions with high Taar2 expression, comparing wild-type and Taar2-knockout or manipulated preparations.

  • Optogenetic approaches: Combine optogenetics with electrophysiology to stimulate specific neuronal populations while recording from Taar2-expressing regions.

  • Calcium imaging: Use genetically encoded calcium indicators to visualize activity in Taar2-expressing neural circuits.

How does Taar2 influence adult neurogenesis, and what methods can best assess this relationship?

TAAR2-KO mice demonstrate increased neuroblast-like and proliferating cell numbers in the subventricular and subgranular zones, indicating enhanced adult neurogenesis . To investigate this relationship:

  • BrdU labeling: Administer bromodeoxyuridine to label proliferating cells, followed by immunohistochemistry to quantify newly formed neurons.

  • Doublecortin (DCX) staining: Immunohistochemical detection of DCX to identify neuroblasts and immature neurons.

  • Fate mapping: Use genetic lineage tracing to track the development of neural stem cells.

  • Functional integration: Combine birthdating with electrophysiological recordings to assess the functional integration of newly formed neurons.

  • Molecular analysis: Examine the expression of neurogenesis-related genes, including BDNF, which shows increased mRNA levels in the striatum of TAAR2-KO mice .

What role might Taar2 play in neuroplasticity beyond neurogenesis?

Taar2's involvement in neuroplasticity likely extends beyond neurogenesis, potentially influencing:

  • Synaptic plasticity: Investigate long-term potentiation (LTP) and depression (LTD) in hippocampal and cortical circuits where Taar2 is expressed.

  • Dendritic spine dynamics: Analyze changes in spine morphology and turnover in Taar2-manipulated neurons.

  • Neurotrophic signaling: Explore interactions between Taar2 and neurotrophic factors, particularly BDNF, which shows altered expression in TAAR2-KO mice .

  • Activity-dependent gene expression: Examine immediate early gene expression following neuronal activation in Taar2-expressing regions.

How can I effectively measure Taar2-related behavioral phenotypes in rodent models?

Based on observed phenotypes in TAAR2-KO mice, the following behavioral assays are recommended:

  • Locomotor activity testing: Open field test to measure spontaneous locomotion and exploratory behavior, which are increased in TAAR2-KO mice .

  • Depression-like behavior: Forced swim test, where TAAR2-KO mice show less immobility .

  • Anxiety assessment: Elevated plus maze and light-dark transition tests, although TAAR2-KO mice showed no significant changes in anxiety levels .

  • Cognitive function: Novel object recognition and spatial memory tasks to assess potential cognitive effects related to Taar2 expression in hippocampus and cortex.

  • Social behavior: Tests of social interaction and preference, which may be affected by altered monoamine signaling.

What is the relationship between Taar2 and dopaminergic transmission?

TAAR2-KO mice exhibit elevated tissue dopamine levels in the striatum and increased dopaminergic neuron numbers in the Substantia Nigra , suggesting Taar2 negatively regulates dopaminergic transmission. To investigate this relationship:

  • Neurochemical analysis: Use high-performance liquid chromatography (HPLC) to measure tissue levels of dopamine and its metabolites.

  • Microdialysis: In vivo measurement of dopamine release in freely moving animals.

  • Fast-scan cyclic voltammetry: Real-time detection of dopamine release in brain slices.

  • Immunohistochemistry: Quantify tyrosine hydroxylase-positive neurons in the substantia nigra and ventral tegmental area.

  • Molecular analysis: Examine expression of genes involved in dopamine synthesis, transport, and metabolism, including MAO-B, which shows increased expression in the striatum and midbrain of TAAR2-KO mice .

How might Taar2 be involved in sleep/wake regulation?

The expression of Taar2 in hypothalamic and thalamic nuclei suggests potential involvement in sleep/wake regulation . To investigate this:

  • Polysomnographic recordings: Measure EEG, EMG, and EOG in Taar2-manipulated animals to assess sleep architecture.

  • Circadian rhythm analysis: Monitor wheel-running activity or home-cage activity over multiple days to detect alterations in circadian patterns.

  • Sleep deprivation studies: Examine responses to sleep deprivation in animals with altered Taar2 function.

  • Molecular clock analysis: Investigate interactions between Taar2 signaling and molecular clock components in the suprachiasmatic nucleus.

What techniques are available for creating recombinant Taar2 models with specific mutations?

Modern genome editing approaches offer precise tools for creating recombinant Taar2 models:

  • CRISPR-Cas9: Design guide RNAs targeting specific regions of the Taar2
    gene to create knockouts or introduce specific mutations. This approach has been successfully used for other TAAR family members .

  • Site-directed mutagenesis: For in vitro studies, introduce specific mutations in Taar2 expression constructs to identify key residues for ligand binding or signaling.

  • Conditional expression systems: Develop models with temporal or tissue-specific control of Taar2 expression using Cre-loxP or tetracycline-inducible systems.

  • Viral vectors: Use AAV or lentiviral vectors for localized manipulation of Taar2 expression in specific brain regions.

How can computational approaches advance our understanding of Taar2 structure and function?

Computational methods offer valuable insights when experimental data is limited:

  • Homology modeling: Generate structural models of rat Taar2 based on known GPCR crystal structures.

  • Molecular dynamics simulations: Predict ligand-receptor interactions and conformational changes associated with receptor activation.

  • In silico screening: Identify potential ligands through virtual screening of chemical libraries.

  • Systems biology approaches: Integrate Taar2 into broader signaling networks to predict functional interactions with other neurotransmitter systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.