Recombinant Rat Trace amine-associated receptor 3 (Taar3)

Shipped with Ice Packs
In Stock

Description

Recombinant Protein Production

Recombinant rat Taar3 is generated using heterologous expression systems, with technical specifications as follows:

ParameterDetails
Expression SystemsE. coli (cytoplasmic) and baculovirus (insect cells)
Purity>85% (SDS-PAGE)
StorageLyophilized form: 12 months at -20°C/-80°C; reconstituted: 1 week at 4°C
ReconstitutionSterile water + 50% glycerol recommended for long-term stability

Ligand Specificity

  • While TAAR1 is well-characterized for binding trace amines (e.g., β-phenylethylamine) and psychostimulants (e.g., amphetamine) , Taar3's ligands are less defined.

  • Rodent TAAR subtypes, including Taar3, may respond to volatile amines, as suggested by olfactory receptor studies .

Immune System Links

  • Taar mRNA is detected in rodent B cells and natural killer (NK) cells, though Taar3-specific immune roles are not yet confirmed .

Species-Specific Variations

  • Human vs. Rat: TAAR3 is a pseudogene in humans but functional in rats, reflecting evolutionary divergence .

  • Structural Divergence: Key residues in the ligand-binding pocket (e.g., position 7.39) differ between rat, mouse, and human TAAR1 homologs, suggesting Taar3 may have unique ligand preferences .

Applications in Research

  • Ligand Screening: Used in in vitro assays to identify agonists/antagonists via cAMP or β-arrestin signaling pathways .

  • Structural Biology: Aids in crystallography or cryo-EM studies to resolve GPCR activation mechanisms .

  • Immunological Studies: Potential tool for probing TAAR-mediated immune modulation .

Challenges and Future Directions

  • Ligand Identification: High-throughput screens are needed to clarify Taar3’s endogenous and synthetic ligands.

  • Functional Validation: In vivo studies are required to elucidate its role in olfaction, metabolism, or immune regulation.

  • Therapeutic Potential: Unlike TAAR1 (targeted by schizophrenia drug candidates like ulotaront), Taar3’s druggability remains unexplored .

Comparative Genomic Analysis of TAAR3

SpeciesTAAR3 StatusGenomic Context
HumanPseudogeneChromosome 6q23.1
RatFunctionalChromosome 1p12 (17 TAAR genes)
MouseFunctionalChromosome 10 (15 TAAR genes)

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All protein shipments are sent with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing it.
Synonyms
Taar3; Trace amine-associated receptor 3; TaR-3; Trace amine receptor 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-342
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Taar3
Target Protein Sequence
MDLIYIPEDLSSCPKFGNKSCPPTNRSFRVRLIMYLLMTGAMVITIFGNLVIIISISHFK QLHSPTNFLILSMATTDFLLGFVIMPYSMVRSVESCWYFGDSFCKFHASFDMMLSLTSIF HLCSIAIDRFYAVCAPLHYTTTMTASMIKRLLFFCWAAPALFSFGLVLSEANVSGMQSYE ILIACFNFCALTFNKFWGTILFTTCFFTPGSIMVGIYGKIFIVSRRHARALGNMPENTKG AGRNLSKKKDRKAAKTLGIVMGVFLACWLPCFLAVLIDPYLDYSTPIIVLDLLVWLGYFN STCNPLIHGFFYPWFRKALEHIVSGKIFRSNSDTANLFPEAH
Uniprot No.

Target Background

Function
Olfactory receptor activated by several primary trace amines, including isoamylamine. Activated by isoamylamine and cyclohexylamine, but not by the corresponding alcohols, isoamylalcohol and cyclohexanol. This receptor is likely mediated by the G(s)-class of G-proteins which activate adenylate cyclase.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Trace Amine-Associated Receptor 3 (Taar3) and how does it relate to other TAARs?

Trace Amine-Associated Receptor 3 (Taar3) belongs to the TAAR family of G protein-coupled receptors that primarily respond to trace amines—biogenic amines present at low concentrations in mammalian tissues. Taar3 shares structural similarities with other TAARs, including seven transmembrane domains characteristic of G protein-coupled receptors.

While specific research on Taar3 is still emerging, knowledge of the TAAR family indicates these receptors generally couple to Gs proteins, activating adenylyl cyclase and increasing intracellular cAMP levels. Taar1, the most studied receptor in this family, is activated by trace amines such as β-phenylethylamine (β-PEA) and 3-iodothyronamine (T1AM) . By analogy, Taar3 likely responds to similar ligands but with different potency and specificity profiles.

What expression patterns does Taar3 exhibit in rat tissues?

Based on research with other TAARs, Taar3 expression is likely tissue-specific and may vary under different physiological conditions. While specific rat Taar3 expression data is limited in the provided search results, TAARs generally show expression patterns relevant to their proposed functions.

For context, research on TAARs in cancer tissues shows expression of multiple TAAR family members, suggesting these receptors may play roles beyond their initially identified functions. In breast cancer studies, TAAR expression patterns correlated with specific cancer subtypes rather than with tumor grade or stage .

Researchers investigating Taar3 expression should consider examining:

  • Neural tissues (brain regions, peripheral nervous system)

  • Endocrine tissues

  • Immune cells

  • Respiratory epithelia (particularly nasal epithelia in the case of olfactory TAARs)

What are the known natural ligands for rat Taar3?

While specific ligands for rat Taar3 are not directly identified in the provided search results, research on other TAARs provides context for potential ligands. Based on studies with Taar1 and other TAARs, potential natural ligands for Taar3 may include:

Potential Ligand ClassExamplesNotes
Trace aminesβ-phenylethylamine (β-PEA), p-tyramine (p-Tyr)These activate Taar1 across multiple species
Thyroid hormone derivatives3-iodothyronamine (T1AM)Shows species-specific potency differences in Taar1
Volatile aminesTrimethylamine, isoamylamineMore common for olfactory TAARs

Functional assays such as cAMP accumulation studies with heterologously expressed rat Taar3 would be necessary to definitively identify and characterize its natural ligands.

How do species differences in Taar3 structure affect ligand binding and function?

Evolutionary analyses of TAAR proteins reveal significant variation in amino acid residues involved in agonist binding, particularly among rodent TAAR orthologs. For instance, research on Taar1 demonstrated that while T1AM, β-PEA, and p-tyramine act as agonists across multiple vertebrate species, the EC50 values for T1AM at rat Taar1 differed significantly compared to other vertebrate Taar1 orthologs .

Similar species-specific differences likely exist for Taar3, with consequences for:

  • Ligand potency and efficacy

  • Signaling pathway coupling

  • Physiological functions

This evolutionary variation suggests specialized roles for Taar3 in different species. Researchers should be cautious when extrapolating findings across species and consider conducting comparative studies when possible.

How might Taar3 interact with other neurotransmitter systems?

TAARs exhibit significant co-expression patterns with other neurotransmitter receptors, suggesting functional interactions. Analysis of TAAR co-expression in breast cancer tissues revealed correlations with genes involved in "Neuroactive ligand–receptor interactions" KEGG pathway .

Specifically, TAARs are co-expressed with G-protein-coupled receptors for monoamine neurotransmitters including:

  • Dopamine receptors

  • Norepinephrine receptors

  • Serotonin receptors

TAAR1 has demonstrated ability to modulate the activity of these monoamine receptors . By analogy, Taar3 might similarly influence monoaminergic neurotransmission, though the specific mechanisms would require dedicated research.

Additionally, genes co-expressed with TAARs in multiple datasets were enriched in components of the "Olfactory transduction" pathway , suggesting functional connections between TAARs and olfactory signaling.

What role might Taar3 play in pathological conditions?

While specific information on Taar3 in disease states is limited in the provided search results, research on other TAARs, particularly in cancer, provides insight into potential pathological roles.

TAARs have been implicated in breast cancer, with expression patterns associated with specific molecular subtypes. Notably, all studied TAARs (TAAR1, TAAR2, TAAR5, TAAR6, TAAR8, and TAAR9) showed significant upregulation in circulating tumor cells compared to metastatic lesions . This suggests potential roles in cancer cell dissemination or survival in circulation.

What are the optimal systems for expressing recombinant rat Taar3?

Based on protocols for similar proteins, several expression systems can be considered for recombinant rat Taar3 production:

Expression SystemAdvantagesConsiderations
E. coli- High yield
- Cost-effective
- Rapid production
- May require refolding
- Limited post-translational modifications
Mammalian cells- Native-like post-translational modifications
- Proper folding
- Lower yield
- Higher cost
- Longer production time
Insect cells- Moderate yield
- Good for membrane proteins
- Intermediate complexity
- Different glycosylation patterns

For functional studies, mammalian expression systems like HEK293 or CHO cells are often preferred for GPCRs to ensure proper folding and membrane insertion. These systems allow for downstream functional assays such as cAMP accumulation or calcium mobilization.

What purification strategies are effective for recombinant rat Taar3?

Purification of membrane proteins like Taar3 requires specialized approaches:

  • Solubilization: Select appropriate detergents that maintain protein structure and function. Common options include:

    • DDM (n-dodecyl-β-D-maltoside)

    • LMNG (lauryl maltose neopentyl glycol)

    • Digitonin for more sensitive applications

  • Affinity Purification: Include an affinity tag (His, FLAG, etc.) for initial capture:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged proteins

    • Anti-FLAG affinity for FLAG-tagged proteins

  • Size Exclusion Chromatography: Further purify and assess protein homogeneity

For quality control, methods similar to those used for other recombinant proteins can be applied:

  • SDS-PAGE under reducing and non-reducing conditions to verify purity and molecular weight

  • N-terminal sequence analysis to confirm protein identity

  • Functional assays to verify biological activity

How can experimental designs be optimized for studying Taar3 function?

When designing experiments to study recombinant rat Taar3 function, consider the following framework:

  • Define Variables Clearly :

    • Independent variables: Different ligands, ligand concentrations, cellular context

    • Dependent variables: cAMP levels, calcium flux, receptor internalization, downstream signaling

    • Control variables: Temperature, pH, expression levels

  • Establish Proper Controls :

    • Positive controls: Known TAAR agonists (e.g., β-PEA for related TAARs)

    • Negative controls: Untransfected cells, inactive ligand analogs

    • Vehicle controls: For solvent effects

  • Randomization and Blinding :

    • Randomize treatment order

    • Blind analysis where possible to prevent bias

  • Dose-Response Relationships:

    • Test multiple concentrations to establish EC50 values

    • Compare with known TAARs (e.g., Taar1) to benchmark pharmacology

What techniques are effective for studying Taar3-mediated signaling?

Several complementary approaches can be used to investigate Taar3 signaling:

  • cAMP Accumulation Assays:

    • ELISA-based detection

    • FRET-based sensors (e.g., EPAC-based)

    • Glosensor technology

  • Calcium Mobilization:

    • Fluorescent calcium indicators (Fluo-4, Fura-2)

    • Genetically encoded calcium indicators (GCaMP)

  • Receptor Trafficking and Internalization:

    • Fluorescently tagged receptors

    • High-content imaging

    • Flow cytometry

  • Downstream Signaling:

    • Phospho-specific antibodies for pathway activation

    • Reporter gene assays

    • RNA-seq for transcriptional effects

How can evolutionary conservation analysis inform Taar3 research?

Evolutionary analyses provide valuable insights into receptor function and ligand specificity. For Taar1, such analyses revealed high structural conservation throughout vertebrate evolution, highlighting its physiological relevance, while also identifying species-specific differences in ligand potency .

A similar approach for Taar3 would involve:

  • Sequence alignment of Taar3 orthologs across vertebrate species

  • Identification of conserved motifs and variable regions

  • Homology modeling based on known GPCR structures

  • Functional testing of key residues through site-directed mutagenesis

This approach could identify:

  • Core structural elements essential for Taar3 function

  • Species-specific adaptations that might correlate with ecological niches

  • Potential ligand binding pockets based on conservation patterns

What are the challenges in developing specific antibodies for rat Taar3?

Developing specific antibodies for GPCRs like Taar3 presents several challenges:

  • High sequence similarity between TAAR family members requires careful epitope selection to ensure specificity

  • Limited extracellular domains accessible for antibody binding in native conformation

  • Low endogenous expression levels make validation difficult

Strategies to overcome these challenges include:

  • Using peptides from N-terminal or extracellular loop regions specific to Taar3

  • Validating antibodies with overexpression systems and knockout controls

  • Employing multiple antibodies targeting different epitopes for confirmation

  • Considering alternative approaches like epitope tagging for localization studies

How might Taar3 research inform understanding of sensory perception?

Several TAARs participate in olfactory processes, and co-expression analysis shows TAARs are associated with genes in the "Olfactory transduction" KEGG pathway . This suggests Taar3 might have sensory functions.

Research directions could include:

  • Localization studies in sensory tissues

  • Behavioral assays measuring responses to potential Taar3 ligands

  • Comparative studies across species with different sensory adaptations

  • Investigation of Taar3 polymorphisms and their potential impact on sensory variation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.