Recombinant Rat Trace amine-associated receptor 5 (Taar5)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rat Trace Amine-Associated Receptor 5 (TAAR5)

Recombinant Rat TAAR5 is a synthetic version of the trace amine-associated receptor 5, a G protein-coupled receptor (GPCR) cloned and expressed in host systems (e.g., E. coli, HEK293 cells) to study its biochemical and physiological roles . In rodents, TAAR5 is primarily recognized for detecting trimethylamine (TMA), a volatile amine present in urine that influences olfactory and social behaviors . Recent studies highlight its dual role in olfactory signaling and limbic system modulation, with implications for emotional regulation and motor control .

Expression Patterns in Rat Brain and Peripheral Tissues

TAAR5 exhibits widespread but low-abundance expression across brain regions and peripheral organs. In rats, studies extrapolated from mouse models indicate:

Region/OrganExpression NotesFunctionSource
Olfactory BulbGlomerular layer and deeper limbic-projecting neurons.Olfactory signal processing.
CerebellumPurkinje cells and vestibular nuclei (medial).Motor coordination, balance.
Limbic AreasAmygdala, hippocampus, nucleus accumbens, orbitofrontal cortex (OFC).Emotional regulation.
Peripheral TissuesTestis, intestines, leukocytes (detected via mRNA).Immune modulation, metabolism.

TAAR5-KO mice show reduced anxiety/depression-like behaviors but improved balance and coordination, underscoring its role in emotional and motor regulation .

Olfactory and Limbic System Regulation

  • Odor Detection: TAAR5 mediates TMA-induced olfactory responses, critical for social interaction .

  • Emotional Behavior: TAAR5-KO mice exhibit reduced serotonin levels in limbic regions, correlating with decreased anxiety/depression .

Motor Control and Sensorimotor Modulation

  • Balance and Coordination: TAAR5-KO mice perform better in static rod tests and vestibular challenges, linked to cerebellar expression .

  • Oscillation Patterns: Altered delta/theta oscillations in motor cortex and striatum suggest TAAR5 modulates neural rhythm dynamics .

Therapeutic Potential

Recent studies identified TAAR5 antagonists using deep learning models (AtomNet®), including:

CompoundIC₅₀ (cAMP Inhibition)EffectsSource
Compound 10.5–1.0 μMBlocks TMA-induced cAMP, ERK/CREB phosphorylation.
Compound 21.0–2.0 μMSimilar efficacy; drug-like properties.

These antagonists show promise as anxiolytic/antidepressant candidates .

Methodological Insights from Recombinant TAAR5 Studies

Recombinant TAAR5 is pivotal for:

  1. BRET Assays: Measuring ligand-induced conformational changes in HEK293 cells .

  2. Signaling Pathway Mapping: Identifying ERK/CREB phosphorylation as downstream targets .

  3. Cross-Species Comparisons: Validating TMA’s role in rat olfaction vs. human aversion .

Challenges and Future Directions

  • Low Expression: TAAR5’s low mRNA/protein levels hinder immunohistochemical validation .

  • Species-Specific Effects: Rat TAAR5’s role remains poorly characterized compared to mouse models.

  • Therapeutic Translation: Optimizing antagonists for clinical use requires further pharmacokinetic profiling .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline for your preparation.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Taar5; Trace amine-associated receptor 5; TaR-5; Trace amine receptor 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-337
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MRAVLLPGSGEQPAAFCYQVNGSCPRTVHPLAIRVLIYLACAVGMLITVLGNLFVVFAVS YFKVLHTPTNFLLLSLALADMLLGLLVLPLSTVRSVESCWFFGDFLCRLHTYLDTLFCLT SIFHLCFISIDRHCAICDPLLYPSKFTVRIALRYIAAGWGIPAAYTAFFLYTDVVERALS QWLEEMPCVGSCQLLFNKFWGWLNFPAFFIPCLIMISLYLKIFVVATRQAQQIRTLSQSL SGAVKRERKAAKTLGIAVGIYLVCWLPFTVDTLVDSLLNFVTPPLVFDIFIWFAYFNSAC NPIIYVFSYRWFRKALKLLLSREILSPRTQTADLFHD
Uniprot No.

Target Background

Function
Trace amine-associated receptor 5 (TAAR5) is an olfactory receptor exhibiting high specificity for trimethylamine, a volatile amine. It also displays lower-level activation by dimethylethylamine. Trimethylamine, a bacterial metabolite found in certain animal odors, is associated with unpleasant smells such as bad breath and spoiled food. TAAR5 signaling likely involves Gs-protein coupled activation of adenylate cyclase.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Trace Amine-Associated Receptor 5 (Taar5) and where is it expressed?

Trace Amine-Associated Receptor 5 (Taar5) is a G protein-coupled receptor that belongs to the TAAR family expressed in mammals. While initially identified in the olfactory system, recent research has revealed its expression extends far beyond olfactory regions. TAAR5 is expressed in multiple limbic brain regions, including the anterior olfactory nucleus, olfactory tubercle, orbitofrontal cortex (OFC), amygdala, hippocampus, piriform cortex, entorhinal cortex, nucleus accumbens, and various thalamic and hypothalamic nuclei . Additional expression has been detected in peripheral organs, including testis, intestines, and leukocytes .

Developmentally, TAAR5 expression varies with age. Transcriptomic analyses of RNA-seq data indicate TAAR5 is expressed in mouse cerebellum at early postnatal stages (P2, P4, and P8), with expression significantly downregulated by P60 . Interestingly, detection in adult tissues may require deeper RNA-seq coverage (60+ million reads per sample) due to relatively low expression levels .

How do researchers generate and validate Taar5 knockout models?

Taar5 knockout (TAAR5-KO) mice are typically generated using homologous recombination techniques. The methodology involves:

  • Creating a replacement vector targeting the Taar5 gene region (typically from base 1 to 320)

  • Inserting a LacZ-coding sequence with a nuclear localization sequence (NLS)

  • Including selection markers (e.g., PgK-NeoR, diphtheria toxin cassette)

  • Linearizing the targeting vector and electroporating it into embryonic stem cells

  • Selecting resistant clones and confirming recombination by PCR

  • Using confirmed ES cell clones to generate chimeras according to standard protocols

Genotyping is performed using PCR with three primers that can detect fragments of different lengths (480bp for wild-type, 600bp for knockout), allowing identification of TAAR5+/+, TAAR5-/-, and TAAR5+/- genotypes . The PCR protocol typically involves:

  • Initial denaturation at 95°C for 2 minutes

  • 35 cycles of: 30s at 95°C, 30s at 60°C, and 60s at 72°C

  • Final elongation for 5 minutes at 72°C

  • Visualization of products on a 2% agarose gel stained with ethidium bromide

Southern blot analysis provides additional validation, comparing restriction enzyme-digested DNA from parent and knockout lines using radiolabeled DNA probes .

What are the primary ligands that activate Taar5?

TAAR5 can be activated by tertiary amines, with trimethylamine (TMA) functioning as a full agonist . TMA is present in mouse urine and produces species-specific responses: it is attractive to mice but repulsive to rats and humans, with these effects mediated through TAAR5 . This differential response highlights the evolutionary significance of TAAR5 in species-specific olfactory processing and social communication.

How does Taar5 knockout affect neurochemical pathways?

TAAR5-KO mice exhibit significant alterations in serotonergic neurotransmission. Studies have documented substantial decreases in tissue levels of serotonin (5-HT) and its metabolites in several brain areas . Additionally, TAAR5-KO mice show increased sensitivity to the hypothermic effects of 8-hydroxy-2-(di-n-propylamino)tetralin (8-OH-DPAT), a 5-HT1A receptor agonist .

These neurochemical changes likely underpin the behavioral phenotypes observed in TAAR5-KO mice, including reduced anxiety- and depressive-like behaviors. The connection between TAAR5 and serotonergic systems suggests that TAAR5 may play a previously unrecognized role in regulating mood and emotional states, potentially through modulation of serotonin signaling pathways.

What transcriptomic changes occur in Taar5 knockout models?

Knockout of TAAR5 induces substantial changes in the striatal transcriptome, as revealed by dimensionality reduction approaches including Multidimensional Scaling (MDS) and Principal Component Analysis (PCA) .

MDS analysis shows that biological replicates from the same group (WT or TAAR5-KO) cluster together, demonstrating clear transcriptomic differences between groups. The first dimension of MDS plots accounts for 28% of transcriptomic variance between samples, though it separates only half of TAAR5-KO samples from WT .

PCA provides clearer separation between TAAR5-KO and WT striatal expression profiles:

  • The first two principal components (PC1 and PC2) capture 89.5% of total variance

  • PC2, representing 17.3% of variability, effectively differentiates between the two groups

These findings suggest that TAAR5 deletion leads to consistent alterations in gene expression patterns in the striatum, which may contribute to the observed behavioral phenotypes.

How does Taar5 knockout influence cognitive performance?

TAAR5-KO mice demonstrate enhanced cognitive performance compared to wild-type littermates in temporal decision-making tasks. Specifically:

  • TAAR5-KO mice make fewer errors during task performance

  • They display a greater rate of improvement over training days

  • They show lower impulsivity, suggesting greater task engagement

  • They adapt more flexibly to environmental changes

The cognitive enhancement is attributable to both decreased timeout trials (indicating greater engagement) and decreased timing errors (indicating improved accuracy). This performance improvement is particularly noticeable during the light phase when mice typically show reduced alertness .

The cognitive advantage does not appear to result from earlier learning but rather from a consistently higher rate of improvement throughout training. This suggests that TAAR5 may modulate specific domains of cognition related to attention, task engagement, and behavioral flexibility .

What role does Taar5 play in motor coordination and balance?

TAAR5-KO mice show interesting and somewhat paradoxical effects on motor skills:

  • Reduced endurance in rotarod tests with fast acceleration (TAAR5-KO: 50.28 ± 2.036s vs. WT: 76.85 ± 5.632s)

  • Better coordination and balance in other motor tests

These findings suggest that TAAR5 differentially modulates distinct aspects of motor function, potentially through its expression in cerebellar and brainstem circuits. The improved balance despite reduced endurance may reflect altered sensorimotor integration or differences in motivation/engagement rather than purely motor deficits.

What methodological approaches are recommended for detecting Taar5 expression?

Detecting TAAR5 expression presents significant technical challenges due to its relatively low abundance. Based on research findings, the following methodological approaches are recommended:

  • RT-qPCR with validated primers: Design specific primers and validate them using positive controls like olfactory epithelium samples or plasmids harboring TAAR5 sequences .

  • Deep RNA sequencing: Detection in adult tissues requires sufficient sequencing depth (60+ million reads per sample), as shown in GSE67556 dataset where TAAR5 was detected in P60 mice only in deeper sequencing runs .

  • Developmental timing: For cerebellum studies, TAAR5 expression is more readily detectable at early postnatal stages (P2-P8) compared to adult tissues .

  • Histochemical detection: In TAAR5-KO mice with LacZ reporter insertion, β-galactosidase staining can map expression patterns across tissues .

  • Control validation: Always include tissue from TAAR5-KO animals as negative controls to confirm specificity of detected signals .

Expected RT-qPCR results from cerebellum and brainstem samples typically show relatively light but well-defined bands in wild-type animals, noticeably weaker than housekeeping gene products, with complete absence of corresponding signals in TAAR5-KO tissues .

How does Taar5 connect olfactory input to emotional behavior?

TAAR5 functions not merely as an odor-sensing receptor but provides critical connectivity between olfactory inputs and limbic brain circuits that regulate emotional behavior . The expression pattern of TAAR5 creates a neural pathway from olfactory detection to emotional processing:

  • TAAR5 is expressed in the glomerular layer of the olfactory bulb

  • It is also expressed in deeper layers that project to limbic brain olfactory circuitry

  • Expression extends to numerous limbic regions involved in emotional processing

  • This anatomical connectivity allows olfactory signals (particularly TMA) to influence emotional states

TAAR5-KO mice show reduced anxiety- and depressive-like behaviors across multiple behavioral tests, suggesting that normal TAAR5 signaling may contribute to baseline anxiety and stress responses . This indicates that certain olfactory inputs processed through TAAR5 may naturally enhance vigilance or defensive behaviors in mice.

What is the developmental timeline of Taar5 expression?

The expression of TAAR5 follows a specific developmental timeline that may provide insights into its functional significance:

  • Early postnatal period: Strong expression is detected in mouse cerebellum at P2, P4, and P8 stages

  • Adolescence and adulthood: Expression is significantly downregulated by P60 compared to P8 (P adj = 5.809e−11)

  • Adult expression patterns: In adult mice, TAAR5 mRNA remains detectable in approximately 50% of cerebellum samples, but requires deeper sequencing techniques for reliable detection

  • Regional differences: The developmental timeline may vary across brain regions, with potentially more stable expression in primary olfactory areas compared to cerebellar regions

This developmental regulation suggests that TAAR5 may play distinctive roles during different life stages, potentially contributing to critical periods of neural circuit development before being downregulated in mature systems.

What behavioral paradigms are most sensitive for assessing Taar5 knockout phenotypes?

Based on research findings, the following behavioral paradigms have successfully identified phenotypic differences in TAAR5-KO mice:

  • Temporal decision-making tasks: The switch task effectively reveals improved cognitive performance, reduced errors, and enhanced behavioral flexibility in TAAR5-KO mice .

  • Anxiety and depression tests: Multiple behavioral tests (not specifically named in the provided materials) have demonstrated reduced anxiety- and depressive-like behaviors in TAAR5-KO mice .

  • Motor coordination assessments:

    • Rotarod test with fast acceleration (30s) followed by maintained maximum speed reveals reduced endurance in TAAR5-KO mice

    • Other coordination and balance tests (not specifically detailed in the provided materials) show improved performance in TAAR5-KO mice

When designing behavioral experiments with TAAR5-KO models, researchers should consider incorporating these paradigms while controlling for time of day effects, as TAAR5-KO mice show differential performance between light and dark phases in cognitive tasks .

What are the molecular mechanisms underlying altered serotonergic function in Taar5 knockout models?

While the search results confirm altered serotonergic function in TAAR5-KO mice, including decreased tissue levels of serotonin and its metabolites in several brain areas and increased sensitivity to 5-HT1A receptor agonists , the precise molecular mechanisms remain an area requiring further investigation.

To elucidate these mechanisms, researchers might consider:

  • Investigating 5-HT receptor expression and density in TAAR5-KO vs. WT mice

  • Examining serotonin transporter function and expression

  • Assessing tryptophan hydroxylase activity and expression

  • Measuring serotonin release using microdialysis or fast-scan cyclic voltammetry

  • Evaluating downstream signaling pathways associated with serotonergic neurotransmission

  • Conducting conditional and region-specific TAAR5 knockout studies to isolate the brain regions responsible for serotonergic alterations

This represents an important area for future research that could reveal novel interactions between trace amine and monoamine signaling systems.

What are the optimal conditions for genotyping Taar5 knockout models?

Based on published protocols, the optimal PCR conditions for genotyping TAAR5 knockout mice are:

  • Primer design: Three primers are required to detect different genotypes:

    • Forward primers: TAG AGC AGG GGG TCA CAG ATG GCA C; GGG GAT CGA TCC GTC CTG TAA GTC T

    • Reverse primer: TGT AGA CAG GGT GAC CAG TTC CCA G

  • PCR reaction composition:

    • 25 μl reaction volume

    • 1× DreamTaq Green buffer

    • 0.14 μM primers

    • 0.2 mM dNTPs

    • 1.2 mM MgCl₂

    • 0.625 U DreamTaq polymerase

  • Thermal cycling conditions:

    • Initial denaturation: 2 min at 95°C

    • 35 cycles of: 30s at 95°C, 30s at 60°C, 60s at 72°C

    • Final elongation: 5 min at 72°C

  • Gel electrophoresis:

    • 2% agarose gel

    • Ethidium bromide staining (0.2 mg/ml)

    • Expected fragment sizes: 480bp (TAAR5+/+), 600bp (TAAR5-/-), or both (TAAR5+/-)

This protocol reliably distinguishes between wild-type, heterozygous, and homozygous knockout genotypes.

How can researchers address the challenge of low Taar5 expression levels in tissue samples?

The low abundance of TAAR5 transcripts presents a significant technical challenge for researchers. Based on the provided information, several strategies can help address this challenge:

  • Increased sequencing depth: For RNA-seq studies, aim for 60+ million reads per sample, as datasets with deeper coverage (e.g., GSE67556 with 200 million reads per sample) successfully detected TAAR5 expression in adult tissues where other studies failed .

  • Developmental timing: Target earlier developmental timepoints (P2-P8) when TAAR5 expression is higher, before the significant downregulation that occurs by P60 .

  • Tissue microdissection: Focus on specific subregions where TAAR5 is more concentrated rather than whole-tissue homogenates that might dilute expression signals.

  • Highly sensitive RT-qPCR protocols: Optimize primer design, template concentration, and cycle parameters specifically for low-abundance transcripts.

  • Positive controls: Always include known TAAR5-expressing tissues (e.g., olfactory epithelium) as positive controls to validate detection methods .

  • Reporter gene approaches: In knockout models with reporter insertions (e.g., LacZ), use histochemical detection methods to visualize expression patterns .

These approaches, used in combination, can significantly improve the detection of TAAR5 expression even in tissues with naturally low abundance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.