Recombinant Rat Trace amine-associated receptor 7a (Taar7a)

Shipped with Ice Packs
In Stock

Description

Genomic and Evolutionary Context

TAAR7 receptors are exclusively found in rodents and exhibit significant inter-species diversity. Key genomic features include:

FeatureRat (rTAAR7a)Mouse (mTAAR7)Human (hTAAR7)
Functional StatusFunctional (paralogues present)Functional (multiple paralogues)Pseudogenized (hTAAR7f)
Chromosomal LocationClustered with TAAR1-9 (inverse orientation)Similar clustering patternDegenerate fragment (closest to rTAAR7h)
Ligand BindingLimited data; inferred from TAAR1Hypothetical binding pocketsNon-functional

Source:

In rats, TAAR7a is part of a gene cluster with TAAR1-9, arranged in inverse orientation, which may influence regulatory mechanisms. In contrast, human TAAR7 genes are non-functional, with hTAAR7f identified as a degenerate fragment .

Potential Ligands and Functional Roles

Recombinant rTAAR7a has not been directly studied, but extrapolation from related receptors suggests:

  • Endogenous Ligands: Tryptamine (TYR), β-phenylethylamine (β-PEA), or other trace amines.

  • Synthetic Ligands: Compounds like Ro5256390 (a TAAR1 agonist) may show cross-reactivity, though species-specific mutations (e.g., I2907.39^{7.39}) could alter affinity .

Challenges and Research Gaps

ChallengeImplications
Lack of Structural DataHinders rational drug design for rTAAR7a.
Pseudogenization in HumansLimits translational relevance to human diseases.
Species-Specific PharmacologyRodent studies may not predict human TAAR biology.

Future Research Directions

  1. Structural Characterization: Cryo-EM or X-ray crystallography of rTAAR7a to map ligand-binding pockets.

  2. Ligand Profiling: High-throughput screening to identify selective agonists/antagonists.

  3. Functional Studies: Assess rTAAR7a’s role in monoaminergic signaling and behavior.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format we have in stock. However, if you have a specific format preference, please indicate your requirement when placing the order. We will prepare the product according to your demand.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution. Store the aliquots at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Taar7a; Ta8; Tar8; Trar8; Trace amine-associated receptor 7a; TaR-7a; Trace amine receptor 7a; Trace amine receptor 8; TaR-8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-358
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Taar7a
Target Protein Sequence
MDKLVDNFLSGQSRTMSEDLLSASSPQLCYENLNGSCIRSPYSPGPRLILYAVFGFGAVL AVCGNLLVMTSILHFRQLHSPANFLVASLACADFLVGLTVMPFSTVRSVEGCWYFGDTYC KFHSCFEGSFCYSSIFHLCFISVDRYIAVSDPLIYPTRFTASVSGKCITFSWLLSIIYSF SLLYTGANEAGLEDLVSALTCVGGCQIAVNQSWVFINFLLFLVPTLVMMTVYSKIFLIAK QQAQNIEKMSKQTTRASESYKDRVAKRERKAAKTLGIAVAAFLLSWLPYFIDSIIDAFLG FITPTYVYEILVWIAYYNSAMNPLIYAFFYPWFRKAIKLIVTGKILRQNSSVTNLFPE
Uniprot No.

Target Background

Function
Trace amine-associated receptor 7a (Taar7a) is an orphan receptor. It is likely to be a receptor for trace amines, which are biogenic amines present in very low levels in mammalian tissues. While some trace amines have established roles as neurotransmitters in invertebrates, their function as true neurotransmitters in vertebrates remains speculative. Trace amines are likely involved in various physiological functions that require further investigation.
Gene References Into Functions
  1. This study demonstrates that the expression of Taar family members is restricted to specific tissue subpopulations and developmental stages in mice. PMID: 17556730
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular characterization of rat TAAR7A?

Rat Trace amine-associated receptor 7a (TAAR7A) is a G-protein coupled receptor encoded by the TAAR7A gene. It is characterized by the UniProt Primary Accession Code Q923Y2 and belongs to the broader family of trace amine-associated receptors . Like other TAARs, rat TAAR7A contains the characteristic amino acid motif NSXXNPXX[YH]XXX[YF]XWF, which overlaps with the putative seventh transmembrane domain and is 100% specific for this receptor family . This receptor is primarily expressed in olfactory epithelium and responds to trace amines and related compounds.

How does rat TAAR7A differ from TAARs in other species?

Rat TAAR7A exhibits significant species-specific differences compared to human and mouse TAARs. These differences are particularly evident in the ligand binding pockets, with variations in key amino acid residues. Similar to the species variations observed in TAAR1, rat TAAR7A likely contains unique residues at positions equivalent to 7.39, 5.42, and within the extracellular loop 2 (EL2) . These specific differences can substantially alter ligand binding properties and signaling responses between species, which is a critical consideration when translating findings between rodent models and human applications.

What are the standard methods for detecting native rat TAAR7A in biological samples?

The standard method for detecting native rat TAAR7A in biological samples is through Enzyme-Linked Immunosorbent Assay (ELISA). Commercial ELISA kits for rat TAAR7A typically have a detection range of 0.156 ng/ml to 10 ng/ml, using a colorimetric detection method . These assays are suitable for various sample types including tissue homogenates, cell lysates, and other biological fluids. When working with native samples, it's important to note that optimal dilutions should be determined empirically for each sample type to ensure measurements fall within the mid-range of the kit's detection limits .

What expression systems are most suitable for producing recombinant rat TAAR7A?

The most suitable expression systems for recombinant rat TAAR7A production are mammalian cell lines (particularly HEK293 and CHO cells) and insect cell systems (Sf9 and High Five cells). While bacterial systems like E. coli are commonly used for recombinant protein expression due to their ease of manipulation and high yield potential , membrane-bound G-protein coupled receptors like TAAR7A typically require eukaryotic expression systems to ensure proper folding, post-translational modifications, and membrane insertion.

For functional studies where proper receptor trafficking and signaling are essential, mammalian expression systems are preferred despite their lower yield. When larger quantities of protein are needed for structural studies, insect cell systems often provide a good compromise between proper folding and higher expression levels.

How can experimental design approaches optimize soluble expression of recombinant rat TAAR7A?

Optimizing soluble expression of recombinant rat TAAR7A requires a systematic experimental design approach that evaluates multiple variables simultaneously. A fractional factorial design (2^8-4 with central point replicates) can efficiently evaluate the effects of key variables while minimizing the number of experiments required .

The following variables should be optimized:

Variable CategorySpecific Factors to Optimize
Medium CompositionInducer concentration, media supplements, pH, nutrient concentrations
Culture ConditionsTemperature, incubation time, aeration rate, cell density at induction
Genetic FactorsPromoter strength, codon optimization, fusion tags, signal sequences
Post-inductionHarvest time, expression duration, detergent selection

This multivariant approach allows for the identification of statistically significant variables and their interactions, providing a more thorough analysis than traditional one-variable-at-a-time methods . For membrane proteins like TAAR7A, special attention should be paid to temperature (often lowered to 16-25°C post-induction) and detergent selection for solubilization while maintaining protein functionality.

What are the critical considerations for designing expression vectors for rat TAAR7A?

When designing expression vectors for rat TAAR7A, several critical factors must be considered:

  • Codon optimization: Adapt the rat TAAR7A coding sequence to the codon usage bias of the chosen expression host to enhance translation efficiency.

  • Fusion tags selection: Include tags that facilitate detection (e.g., FLAG, HA) and purification (e.g., His-tag, GST) while minimizing interference with receptor folding and function. Consider incorporating a cleavable linker to remove the tag if needed for functional studies.

  • Signal sequences: Include appropriate signal peptides to ensure proper trafficking to the plasma membrane in eukaryotic cells.

  • Promoter selection: Choose inducible promoters (e.g., tetracycline-regulated) that allow tight control of expression to minimize toxicity effects that can occur with constitutive expression of membrane proteins.

  • Incorporation of mutations: Consider introducing mutations at residue positions equivalent to 7.39, 5.42, and EL2 regions to enhance stability or create binding site variants for comparative studies .

The final construct should be verified by sequencing and tested for expression efficiency in small-scale pilot experiments before scaling up.

What are the validated methods for assessing rat TAAR7A functional activity?

Several complementary approaches can be used to assess the functional activity of recombinant rat TAAR7A:

  • cAMP Accumulation Assays: Since TAARs primarily couple to Gαs proteins, measuring increases in intracellular cAMP is a standard approach. This can be done using ELISA-based detection kits or real-time biosensors like GloSensor™ or BRET-based sensors.

  • Calcium Mobilization Assays: Using calcium-sensitive fluorescent dyes (e.g., Fluo-4, Fura-2) to detect receptor activation through Gαq coupling or through promiscuous G proteins like Gα15/16.

  • β-Arrestin Recruitment Assays: BRET or FRET-based assays to measure receptor internalization and desensitization pathways.

  • GTPγS Binding Assays: For direct measurement of G protein activation using radiolabeled or fluorescent GTPγS.

When using these assays, it's essential to include appropriate positive and negative controls, and to carefully optimize assay conditions for the specific cell line and receptor construct being used.

How can site-directed mutagenesis be used to study ligand binding domains in rat TAAR7A?

Site-directed mutagenesis is a powerful approach for investigating ligand binding domains in rat TAAR7A. Based on sequence homology with other TAARs and structural information from related receptors, the following experimental approach is recommended:

  • Identify key residues likely involved in ligand binding, focusing on:

    • The conserved aspartate residue in TM3 (equivalent to D3.32 in TAAR1) that coordinates the amine group of ligands

    • Residues in TM5, TM6, and TM7 that form the binding pocket

    • Extracellular loop residues that may contribute to ligand selectivity

  • Design alanine scanning mutagenesis for initial broad characterization, followed by more specific mutations based on:

    • Conservative substitutions to test the importance of specific chemical properties

    • Cross-species substitutions to understand species differences

    • Introduction of reporter groups for biophysical studies

  • Evaluate mutant receptors using:

    • Expression level assays to ensure proper folding

    • Ligand binding assays with varying concentrations to determine changes in affinity (Kd)

    • Functional assays to assess changes in potency (EC50) and efficacy (Emax)

The data should be analyzed to create a comprehensive model of the ligand binding pocket, potentially revealing key interactions that could be targeted for drug design.

What are the most effective methods for identifying novel ligands for rat TAAR7A?

Identifying novel ligands for rat TAAR7A requires a multi-faceted screening approach:

Screening MethodAdvantagesConsiderations
Virtual ScreeningCost-effective, rapid, can screen millions of compoundsRequires structural data or homology models
High-Throughput Functional AssaysDirect measurement of receptor activation, physiologically relevantLabor-intensive, requires optimization
Fragment-Based ScreeningIdentifies novel chemical scaffolds, can detect weak interactionsSpecialized equipment needed, follow-up chemistry required
Targeted LibrariesHigher hit rates from focused compound collectionsMay miss novel chemical spaces

For rat TAAR7A, trace amines (β-phenylethylamine, tyramine), volatile amines, and thyronamine derivatives should be included in initial screens based on known ligands for other TAARs . Given the sequence similarity between TAARs and other aminergic receptors, cross-screening with ligands of 5-HT receptors may also yield interesting findings. All hits should be validated with dose-response curves and counter-screened against other receptor subtypes to determine selectivity.

How should experiments be designed to study species differences between rat, mouse, and human TAAR7A?

To systematically study species differences between rat, mouse, and human TAAR7A, design experiments that combine comparative pharmacology with molecular biology approaches:

  • Receptor expression characterization:

    • Quantify native receptor expression levels across tissues in all three species using RT-qPCR

    • Compare subcellular localization using species-specific antibodies or epitope-tagged constructs

  • Comparative pharmacology:

    • Design a pharmacological profiling panel with diverse ligands tested across all three species' receptors expressed in the same cell system

    • Determine complete concentration-response relationships for each ligand-receptor pair

    • Create a heat map of potency and efficacy data to visualize species differences

  • Molecular basis of differences:

    • Generate chimeric receptors by swapping domains between species

    • Perform site-directed mutagenesis focusing on positions 7.39, 5.42, and EL2 regions known to affect ligand binding in related receptors

    • Validate findings using homology models based on available GPCR crystal structures

This systematic approach allows for identification of specific amino acid differences responsible for functional variations between species, which is crucial for translational research and interpreting rodent model data in the context of human biology.

What controls and validation steps are essential when studying recombinant rat TAAR7A?

When studying recombinant rat TAAR7A, the following controls and validation steps are essential:

  • Expression validation:

    • Western blot analysis to confirm expression at the expected molecular weight

    • Flow cytometry or immunofluorescence to verify cell surface expression

    • Quantitative comparison of expression levels between experimental conditions

  • Functional validation:

    • Positive control using known TAAR ligands with established responses

    • Negative control using cells transfected with empty vector

    • Dose-response curve analysis to ensure sensitivity is within expected ranges

  • Pharmacological validation:

    • Antagonist controls to confirm signal specificity

    • Testing structurally similar compounds to establish structure-activity relationships

    • Cross-reactivity testing with other receptor subtypes

  • Technical controls:

    • Include the D3.32N mutation (equivalent to the D103N in TAAR1) as a negative control, as this mutation typically abolishes amine recognition

    • Use a well-characterized reference GPCR (e.g., β2-adrenergic receptor) as a system validation control

    • Include inter-assay calibrators to allow normalization between experiments

These rigorous controls ensure that observed effects are specifically attributable to rat TAAR7A activity and not to experimental artifacts or non-specific effects.

How can the stability of recombinant rat TAAR7A be optimized for structural studies?

Optimizing the stability of recombinant rat TAAR7A for structural studies requires addressing several challenges inherent to membrane proteins:

  • Construct optimization:

    • Truncate N- and C-terminal regions to remove disordered segments

    • Introduce thermostabilizing mutations identified through alanine scanning or directed evolution

    • Consider fusion partners that enhance crystallization, such as T4 lysozyme or BRIL inserted into a loop region

  • Expression system selection:

    • Use insect cell systems (Sf9, High Five) for higher protein yields

    • Consider specialized mammalian cell lines designed for membrane protein expression

    • Optimize culture conditions using statistical design of experiments approach

  • Purification strategy:

    • Screen multiple detergents systematically (maltoside series, neopentyl glycols, facial amphiphiles)

    • Test lipid-like additives (cholesterol hemisuccinate, specific phospholipids)

    • Employ SEC-based thermostability assays to quantitatively compare conditions

  • Alternative approaches:

    • Consider nanodiscs or SMALPs for detergent-free extraction

    • Evaluate antibody fragments or nanobodies as stabilizing binding partners

    • Explore conformational stabilization using high-affinity ligands

For crystallography or cryo-EM studies, monodispersity of the sample is crucial and should be verified by size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) before structural studies are attempted.

How should researchers analyze complex datasets from TAAR7A signaling experiments?

Analysis of complex datasets from TAAR7A signaling experiments requires a systematic approach:

  • Data preprocessing:

    • Normalize raw data to account for variations in receptor expression levels

    • Apply appropriate transformations (e.g., log transformation for concentration data)

    • Filter outliers using statistical methods (e.g., ROUT method with Q=1%)

  • Pharmacological analysis:

    • Fit concentration-response data to appropriate models (e.g., four-parameter logistic equation)

    • Calculate and compare key parameters (EC50, Emax, Hill slope)

    • For partial agonists, calculate relative efficacy compared to reference compounds

  • Statistical analysis:

    • Use two-way ANOVA to evaluate effects across multiple conditions and treatments

    • Apply appropriate post-hoc tests with corrections for multiple comparisons

    • Calculate 95% confidence intervals for all reported parameters

  • Visualization techniques:

    • Create normalized heat maps for comparing multiple compounds across parameters

    • Use radar plots for multiparameter fingerprinting of ligand responses

    • Implement principal component analysis for pattern recognition in complex datasets

For bias analysis (comparing different signaling pathways), calculate transduction coefficients or operational model parameters to quantify pathway preferences of different ligands. This approach enables the identification of ligands with unique signaling profiles that may have different physiological effects.

What are the common pitfalls in interpreting TAAR7A functional data and how can they be avoided?

When interpreting functional data for rat TAAR7A, researchers should be aware of these common pitfalls and their solutions:

  • Expression level variations:

    • Pitfall: Differences in receptor expression levels between conditions can masquerade as pharmacological differences

    • Solution: Quantify receptor expression for each condition and either normalize data or maintain consistent expression levels

  • Constitutive activity considerations:

    • Pitfall: Missing or misinterpreting constitutive activity of the receptor

    • Solution: Include inverse agonist controls and analyze data with models that account for basal activity

  • Signaling pathway crosstalk:

    • Pitfall: Attributing effects to direct receptor activation when they may result from crosstalk

    • Solution: Use pathway-specific inhibitors and perform experiments in cells with reduced expression of potential crosstalk components

  • Species differences misinterpretation:

    • Pitfall: Directly extrapolating findings from rat TAAR7A to human TAARs

    • Solution: Always include cross-species comparisons when making translational claims

  • Technical artifacts:

    • Pitfall: Fluorescent or toxic compounds giving false positives or negatives

    • Solution: Include counter-screens and orthogonal assays to confirm activity

How can contradictory data from different experimental approaches studying rat TAAR7A be reconciled?

When faced with contradictory data from different experimental approaches studying rat TAAR7A, a systematic reconciliation process should be followed:

  • Methodological evaluation:

    • Compare sensitivity, dynamic range, and signal-to-noise ratios of different assays

    • Assess the potential for assay-specific artifacts or interference

    • Consider whether differences in time resolution between assays could explain disparities

  • Biological context assessment:

    • Evaluate cell-type specific factors (G protein expression levels, RGS proteins, scaffolding proteins)

    • Consider receptor expression levels and their impact on signaling efficiency

    • Assess receptor reserves which can mask partial agonism in highly sensitive systems

  • Statistical reanalysis:

    • Pool raw data from multiple experiments when possible

    • Perform power analysis to ensure adequate sample sizes

    • Consider Bayesian approaches to integrate data from different sources

  • Targeted follow-up experiments:

    • Design experiments specifically to address discrepancies

    • Use orthogonal approaches to validate key findings

    • Consider in vivo or ex vivo systems to resolve in vitro contradictions

A reconciliation table should be created that explicitly compares contradictory findings, identifies potential sources of discrepancies, and proposes a unified interpretation supported by the strongest available evidence. This approach transforms apparent contradictions into opportunities for deeper mechanistic understanding of rat TAAR7A biology.

How can CRISPR/Cas9 gene editing be applied to study rat TAAR7A function in vivo?

CRISPR/Cas9 gene editing offers powerful approaches for studying rat TAAR7A function in vivo:

  • Knockout models:

    • Design sgRNAs targeting early exons of rat TAAR7A

    • Generate complete knockouts to study loss-of-function phenotypes

    • Create conditional knockouts using Cre-loxP systems for tissue-specific deletion

  • Knockin modifications:

    • Introduce reporter tags (e.g., fluorescent proteins) to track native expression

    • Create point mutations to study specific amino acid contributions

    • Generate humanized rats by replacing rat TAAR7A with human TAAR sequences

  • Regulatory element manipulation:

    • Edit promoter or enhancer regions to study transcriptional regulation

    • Create inducible expression systems for temporal control

    • Introduce sensors for in vivo activity monitoring

  • Multiplexed editing:

    • Target multiple TAAR family members simultaneously to address redundancy

    • Create combinatorial modifications across signaling pathway components

    • Perform CRISPR screens to identify genes that modulate TAAR7A function

When implementing these approaches, it's critical to thoroughly validate the editing efficiency and specificity using sequencing, to include appropriate controls, and to consider potential compensatory mechanisms that may emerge in knockout models.

What computational approaches are most effective for predicting rat TAAR7A structure and ligand interactions?

Effective computational approaches for predicting rat TAAR7A structure and ligand interactions include:

  • Homology modeling:

    • Base models on recently determined TAAR1 structures

    • Include multiple templates, particularly from 5-HT4R given structural similarity to TAARs

    • Refine models with molecular dynamics simulations in membrane environments

  • Ligand docking approaches:

    • Use ensemble docking against multiple receptor conformations

    • Implement induced-fit protocols to account for binding pocket flexibility

    • Validate docking poses through mutagenesis experiments

  • Molecular dynamics simulations:

    • Perform microsecond-scale simulations in explicit lipid bilayers

    • Calculate binding free energies using enhanced sampling methods

    • Identify water-mediated interactions and structural waters

  • Machine learning integration:

    • Train models on available TAAR binding data to predict novel ligands

    • Use deep learning approaches for binding affinity prediction

    • Implement graph neural networks for structure-activity relationship analysis

The most effective approach combines these computational methods with experimental validation in an iterative process. For rat TAAR7A specifically, models should account for the characteristic TAAR motif (NSXXNPXX[YH]XXX[YF]XWF) and incorporate species-specific variations at positions 7.39, 5.42, and in EL2 regions .

How can recombinant rat TAAR7A be utilized in drug discovery for neuropsychiatric conditions?

Recombinant rat TAAR7A can be strategically utilized in drug discovery for neuropsychiatric conditions through a multi-phase approach:

  • Target validation:

    • Establish relevance of TAAR7A to specific neuropsychiatric conditions through genetic association studies

    • Map receptor expression in brain regions implicated in disease pathophysiology

    • Correlate endogenous ligand levels with disease states

  • High-throughput screening platform development:

    • Establish stable cell lines expressing rat TAAR7A linked to robust readout systems

    • Develop parallel assays for rat and human receptors to address translation

    • Create multiplexed assays to assess selectivity against other TAAR subtypes

  • Lead optimization strategy:

    • Use rat TAAR7A for initial SAR studies and potency optimization

    • Test promising compounds in rat behavioral models

    • Compare activity between rat and human receptors to guide medicinal chemistry

  • Translational approach:

    • Develop PET ligands based on high-affinity TAAR7A compounds for target engagement studies

    • Design appropriate biomarkers to track treatment effects

    • Validate findings in relevant disease models before clinical translation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.