Recombinant Rat Trace amine-associated receptor 7b (Taar7b)

Shipped with Ice Packs
In Stock

Description

Research Insights and Functional Studies

While direct functional data on Taar7b is limited, structural and pharmacological insights from related TAARs (e.g., human TAAR1) provide context:

  • Ligand Binding: TAARs bind trace amines (e.g., β-phenylethylamine, tryptamine) and thyroid hormone derivatives (e.g., 3-iodothyronamine) . Mutations in conserved residues (e.g., S107C in human TAAR1) disrupt high-affinity ligand binding, suggesting analogous mechanisms in Taar7b .

  • Signaling Pathways: TAARs couple to Gαs proteins, activating adenylate cyclase and cAMP signaling . Rat Taar7b may share this pathway, though specific studies are pending.

Applications in Research

Recombinant Taar7b is used in:

  1. Ligand Screening: Identifying novel agonists/antagonists for trace amine signaling pathways .

  2. Structural Biology: Crystallization or cryo-EM studies to resolve receptor conformation in ligand-bound states (e.g., analogous to human TAAR1-Gs complexes) .

  3. Toxicology: Studying interactions with psychoactive compounds (e.g., amphetamines, MDMA) that modulate trace amine systems .

Comparative Analysis of TAAR Family Members

ReceptorSpeciesLigandsChromosomal LocationKey Function
Taar7bRatTrace amines (putative)1p12Potential role in neuroregulation
TAAR1Humanβ-PEA, 3-Iodothyronamine6q23.1Modulates monoaminergic signaling
TAAR9MouseVolatile amines (e.g., trimethylamine)10Detects microbial metabolites

Future Directions

  • Functional Characterization: Confirming Taar7b’s endogenous ligands and signaling partners.

  • Therapeutic Potential: Exploring its role in neuropsychiatric disorders (e.g., depression, schizophrenia) linked to trace amine dysregulation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Taar7b; Ta12; Tar12; Trar12; Trace amine-associated receptor 7b; TaR-7b; Trace amine receptor 7b; Trace amine receptor 12; TaR-12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-358
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Taar7b
Target Protein Sequence
MATDDDRFPWDQDSILSRDLLSASSMQLCYEKLNRSCVRSPYSPGPRLILYAVFGFGAVL AVCGNLLVMTSILHFRQLHSPANFLVASLACADFLVGLTVMPFSMVRSVEGCWYFGDIYC KFHSSFDGSFCYSSIFHLCFISADRYIAVSDPLIYPTRFTASVSGKCITFSWLLSIIYSF SLFYTGVNEAGLEDLVSALTCVGGCQIAVNQSWVFINFLLFLVPALVMMTVYSKIFLIAK QQAQNIEKMGKQTARASESYKDRVAKRERKAAKTLGIAVAAFLLSWLPYFIDSIIDAFLG FVTPTYVYEILVWIGYYNSAMNPLIYAFFYPWFRKAIKLIVTGKILRENSSATNLFPE
Uniprot No.

Target Background

Function
Trace amine-associated receptor 7b (Taar7b) is an orphan receptor, potentially acting as a receptor for trace amines. Trace amines are biogenic amines found in low concentrations in mammalian tissues. While their roles as neurotransmitters are well-established in invertebrates, their function in vertebrates remains largely speculative. They are likely involved in various, yet to be fully understood, physiological processes.
Gene References Into Functions
  1. Expression of Taar family members is restricted to specific tissue subpopulations and developmental stages in mice. PMID: 17556730
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Trace Amine-Associated Receptor 7b (Taar7b) and how is it expressed in rat olfactory systems?

Taar7b belongs to the trace amine-associated receptor family expressed in the olfactory epithelium. In rodents, Taar genes are arranged in a single cluster on chromosome 10 and are numbered based on their chromosomal order. Specifically, Taar7b is expressed more ventrally in the olfactory epithelium compared to other TAARs . These receptors constitute a distinct olfactory subsystem separate from conventional olfactory receptors (ORs), evidenced by the fact that Taar genes do not co-express with OR genes .

The functional significance of this ventral expression pattern relates to the specialized detection of volatile amines that serve as predator signals or social cues, triggering innate behaviors essential for survival . When studying Taar7b expression, researchers should consider the spatial organization of the olfactory epithelium and use zone-specific markers to accurately characterize expression patterns.

What are the optimal methods for producing recombinant Taar7b protein for research applications?

Production of recombinant Taar7b protein typically follows protocols similar to other membrane-bound receptors in the TAAR family. Based on established methods for related proteins, the recommended approach involves:

  • Expression System Selection: Mammalian expression systems (particularly HEK293 or CHO cells) are preferable to bacterial systems due to the need for proper post-translational modifications and membrane insertion.

  • Construct Design: Include an N-terminal tag (such as 6-His) for purification purposes, similar to the approach used for other recombinant proteins . The construct should contain the sequence encoding Taar7b with appropriate flanking regions for membrane insertion.

  • Purification Strategy: Lyophilization from a filtered solution containing stabilizing buffers (similar to NaH₂PO₄, NaCl, and EDTA used for related proteins) .

  • Carrier Protein Considerations: Consider including bovine serum albumin (BSA) as a carrier protein to enhance stability and shelf-life, particularly for long-term storage and cell culture applications . For applications where BSA might interfere, a carrier-free version may be necessary.

How should researchers design ligand screening assays for rat Taar7b?

Ligand screening for rat Taar7b requires a methodical approach that addresses both the receptor's membrane localization and signaling properties:

  • Cell-Based Reporter Systems: Establish stable cell lines expressing rat Taar7b coupled to appropriate reporter systems (typically cAMP or calcium mobilization assays) to monitor receptor activation.

  • Positive Controls: Include structurally related compounds known to activate other TAARs, such as trace amines that activate TAAR1, as reference points .

  • Screening Library Design: Focus on volatile amines and structurally related compounds, particularly those with ethological relevance as predator signals or social cues based on TAAR family preferences .

  • Dose-Response Assessment: Determine EC₅₀ values using concentration ranges typically between 1 nM to 100 μM, following approaches similar to those used for TAAR1 ligand characterization .

  • Cross-Reactivity Testing: Evaluate specificity by testing candidate ligands against other TAAR family members and structurally related receptors to establish selectivity profiles.

What are the most effective methods for analyzing Taar7b gene regulation and enhancer activity?

Based on research into TAAR enhancer regions, several methodological approaches have proven effective:

  • ATAC-seq Analysis: Perform assay for transposase-accessible chromatin using sequencing on purified TAAR-expressing OSNs to identify regulatory regions. Previous research has identified two TAAR enhancers in the Taar gene cluster, with enhancer 1 located between Taar1 and Taar2, and enhancer 2 between Taar6 and Taar7a .

  • Conserved Motif Identification: Analyze enhancer regions for transcription factor binding sites, particularly focusing on Lhx2-binding motifs, Ebf-binding motifs, and Lhx2/Ebf composite motifs which have been identified in TAAR enhancers .

  • Functional Validation: Employ gene deletion studies targeting transcription factors such as Lhx2 or Ldb1 to assess their impact on Taar7b expression, as these factors have been implicated in the formation of enhancer hubs for related receptors .

  • Chromatin Conformation Analysis: Consider Hi-C analysis to provide direct evidence for enhancer hub formation in TAAR-expressing olfactory sensory neurons, which would extend current understanding of Taar gene regulation mechanisms .

How should researchers interpret contradictory data when characterizing Taar7b ligand interactions?

When faced with contradictory data regarding Taar7b ligand interactions, implement the following systematic analysis approach:

  • Assay System Comparison: Evaluate whether contradictions arise from differences in assay systems (cell types, coupling efficiency, reporter systems) rather than true pharmacological differences.

  • Structure-Activity Relationship (SAR) Analysis: Organize compounds into structural classes and analyze activity patterns within each class. For example, with TAAR ligands, minor modifications such as replacing an oxy-ethylamino sidechain with an ethylamino group or substituting amino groups with hydroxyl moieties can significantly alter potency .

  • Receptor Modeling: Employ computational approaches to develop receptor homology models based on related GPCRs with resolved structures. This can help predict binding modes and reconcile apparently contradictory data, as demonstrated for TAAR1 .

  • Binding vs. Functional Data Analysis: Create correlation plots between binding affinity and functional potency to identify biased ligands or those with unique signaling properties.

Analysis MethodApplication to Contradictory DataExpected Outcome
Multiple Assay PlatformsTest compounds in ≥3 different functional assaysIdentification of assay-specific vs. true pharmacological effects
Receptor MutagenesisSystematic mutation of predicted binding pocket residuesValidation of key interaction points for different ligand classes
Molecular DynamicsSimulation of ligand-receptor complexes over timeExplanation of unexpected structure-activity relationships
Biophysical MethodsDirect binding measurements (SPR, ITC)Confirmation of true binding events independent of signaling

What statistical approaches are most appropriate for analyzing Taar7b expression data across different rat populations?

When analyzing Taar7b expression data across rat populations, consider these statistical approaches:

  • Hierarchical Clustering: For identifying patterns of co-expression with other genes in the olfactory epithelium.

  • Bayesian Methods: Particularly useful when incorporating prior information about TAAR expression patterns or when dealing with small sample sizes, similar to approaches used in analyzing rat population data .

  • Mixed Effects Models: To account for both fixed effects (e.g., experimental conditions) and random effects (e.g., individual rat variation) when analyzing expression levels across multiple groups.

  • Non-Parametric Tests: For data that doesn't follow normal distribution, such as Mann-Whitney U test or Kruskal-Wallis test, which are often more appropriate for gene expression data.

  • Multiple Testing Correction: Apply methods such as Benjamini-Hochberg procedure to control false discovery rate when analyzing expression across multiple genes or conditions.

How can computational methods be optimized for discovering novel ligands for rat Taar7b?

Building on approaches used for related receptors like TAAR1 and TAAR5, computational methods for Taar7b ligand discovery can be optimized through:

  • Homology Model Development: Construct receptor models using related GPCRs as templates, such as β2-adrenoreceptors (PDB ID = 3PDS has been used successfully for TAAR1) .

  • Sequential Refinement Process:

    • Align target sequence to template using appropriate matrices (e.g., BLOSUM62)

    • Perform loop searches to rebuild missing portions

    • Select models based on packing quality function

    • Validate using Ramachandran plots

  • Docking Protocol Optimization:

    • Implement multiple docking algorithms (e.g., Surflex and genetic algorithms)

    • Select poses based on scoring functions and RMSD values

    • Perform energy minimization of ligand-receptor complexes

  • Pharmacophore Model Development: Based on known agonists of related TAARs, a pharmacophore model should incorporate:

    • H-bond donor/acceptor features analogous to hydroxyl groups

    • Positively charged amine features

    • Aromatic features for ring systems

    • Hydrophobic features for alkyl substituents

  • Virtual Screening Validation: Test the computational model by screening a small set of known TAAR ligands mixed with decoys to ensure enrichment of active compounds.

What are the current challenges in understanding the role of Taar7b in the broader context of olfactory signal processing?

Current research challenges in understanding Taar7b's role in olfactory processing include:

  • Enhancer Coordination Mechanisms: While two TAAR enhancers have been identified in the Taar gene cluster, the precise mechanisms by which these enhancers coordinate expression of specific TAAR genes, including Taar7b, remains incompletely understood .

  • Heterochromatin Mark Differentiation: The Taar gene cluster is decorated by different heterochromatic marks in TAAR versus OR OSNs, but the functional consequences of these epigenetic differences for Taar7b expression and regulation require further investigation .

  • Enhancer Hub Formation: Although the involvement of factors like Lhx2, Ebf, and Ldb1 in TAAR enhancer function has been suggested, direct evidence for enhancer hub formation specifically in Taar7b-expressing neurons requires Hi-C analysis or similar approaches .

  • Signal Integration: Understanding how Taar7b-mediated signals are integrated with inputs from other chemosensory receptors in the olfactory system remains challenging.

  • Behavioral Significance: While TAARs generally respond to volatile amines that serve as predator signals or social cues, the specific behavioral responses mediated by Taar7b activation and their ethological significance require further elucidation through carefully designed behavioral assays .

How do findings from rat Taar7b studies translate to understanding human TAAR function?

Translating findings from rat Taar7b to human TAAR research requires careful consideration of several factors:

  • Evolutionary Conservation Analysis: Conduct comparative genomics to identify conserved and divergent features between rat Taar7b and human TAAR orthologues.

  • Differential Expression Patterns: Recognize that expression patterns may differ significantly between species - while Taar7b shows ventral expression in rat olfactory epithelium , human expression patterns may differ in ways that affect functional interpretation.

  • Ligand Responsiveness Comparison: Test identified rat Taar7b ligands against human TAAR receptors to establish cross-species pharmacological profiles using standardized assay systems.

  • Regulatory Element Conservation: Analyze whether enhancer elements identified in the rat Taar cluster (between Taar6 and Taar7a) have functional homologues in the human genome, which would suggest conserved regulatory mechanisms.

  • Methodological Adaptations: When translating experimental approaches from rat to human systems, adjust techniques for heterologous expression, considering differences in cellular trafficking and post-translational modifications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.