Recombinant Rat Trace amine-associated receptor 7c (Taar7c)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on your purchasing method and location. Please consult your local distributor for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. You may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
Taar7c; Trace amine-associated receptor 7c; TaR-7c; Trace amine receptor 7c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-358
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Taar7c
Target Protein Sequence
MATDDDSFPWDQDSILSRDLLSASSLQLCYENLNRSCVRSPYSPGSRLILYAVFGFGAVL AVCGNLLVMTSILHFRQLHSPANFLVASLACADLLVGLTVMPFSMVRSVEGCWYFGNTYC KFHSCFEGSFCYSSLFHLCFISLDRYIAVSDPLIYPTRFTASISGKCITFSWLLSIIYSF SLLYTGANEAGLEDLVSALTCVGGCQVAVNQSWVFINFLLFLVPALVMMTVYSKIFLIAK QQAQNIEKMSKQTARASESYKDRVAKRERKAAKTLGIAVAAFLLSWLPYFIDSIIDAFLG FITPTYMYEILVWIVYYNSAMNPLIYAFFYPWFRKAIKLIVTGKILRENSSTINLFPE
Uniprot No.

Target Background

Function
Trace amine-associated receptor 7c (Taar7c) is an orphan receptor that may act as a receptor for trace amines. Trace amines are biogenic amines found in very low concentrations in mammalian tissues. While some trace amines have established roles as neurotransmitters in invertebrates, their function as true neurotransmitters in vertebrates remains under investigation. Trace amines are likely involved in various physiological processes that require further elucidation.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Trace Amine-Associated Receptor 7c (Taar7c) and how does it relate to other TAARs?

Unlike TAAR1, which is expressed in various tissues and has been implicated in mood disorders and drug abuse, Taar7c belongs to a subfamily of TAARs that shows more restricted expression patterns. The methodological approach to studying newly identified TAARs typically involves sequence alignment with known members like TAAR1, followed by structural modeling based on established GPCR structures such as the β2-adrenergic receptor .

What expression systems are most effective for producing functional recombinant rat Taar7c?

For effective expression of functional recombinant rat Taar7c, researchers should consider several expression systems that have proven successful with other TAAR family members. Human embryonic kidney (HEK-293) cells have been successfully used for heterologous expression of rat TAAR1 and would likely be suitable for Taar7c as well. When establishing stable cell lines expressing Taar7c, challenges may arise similar to those encountered with human TAAR1, which has proven difficult to stably express in cell lines .

For transient expression, a combination of the target receptor with reporter genes (such as luciferase with a CRE-driven promoter) can provide an effective system for assessing receptor functionality. This approach was effective for studying human TAAR1 when stable expression was challenging. If facing expression difficulties, consider creating chimeric constructs with portions from more readily expressed TAAR family members, as was done with the human-rat chimera for TAAR1 .

What are the recommended storage and handling protocols for recombinant rat Taar7c protein preparations?

Based on established protocols for similar recombinant proteins, the following storage and handling guidelines are recommended for recombinant rat Taar7c:

  • Formulation: Recombinant Taar7c protein is typically lyophilized from a 0.2 μm filtered solution in a buffer containing sodium phosphate, sodium chloride, and EDTA, with bovine serum albumin (BSA) as a carrier protein to enhance stability .

  • Reconstitution: Reconstitute at 100 μg/mL in PBS containing at least 0.1% human or bovine serum albumin. For carrier-free preparations, reconstitute at the same concentration in PBS without additional proteins .

  • Storage conditions: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. After reconstitution, aliquot the protein and store at -80°C for long-term stability .

  • Shipping: The protein can be shipped at ambient temperature, but upon receipt, it should be immediately stored according to the recommended temperature conditions .

How can site-directed mutagenesis be used to investigate ligand binding domains in rat Taar7c?

Site-directed mutagenesis represents a powerful approach for investigating ligand binding domains in rat Taar7c, similar to studies conducted with TAAR1. When implementing this methodology, researchers should:

  • Begin by conducting sequence alignments between rat Taar7c and well-characterized GPCRs like the β2-adrenergic receptor (β2AR) to identify conserved or variant residues in putative ligand-binding domains. This comparative approach helps identify key transmembrane domain residues that may participate in ligand binding .

  • Prioritize mutation targets in transmembrane domains (TMs) 3, 6, and 7, as these regions have been demonstrated to contain critical ligand interaction sites in TAAR1. Specifically, in TAAR1 research, mutations in TM6 (M6.55T) and TM7 (N7.39Y) produced significant changes in ligand potency and stereoselectivity .

  • Design mutations that swap amino acids between species variants of Taar7c to investigate species-dependent differences in ligand recognition and binding. This approach successfully revealed that residue 7.39 in TM7 was responsible for species-specific stereoselectivity in TAAR1 .

  • Integrate structural modeling with functional assays to correlate structural changes with receptor function. Computer-generated models showing the putative seven transmembrane domains as alpha helices, with highlighted mutation sites, provide valuable visual information about potential ligand-receptor interactions .

What are the critical differences in pharmacological profiles between rat Taar7c and other species homologs?

Understanding species differences in Taar7c pharmacology is essential for translational research and accurate interpretation of animal model data. While specific pharmacological profiles for Taar7c across species are being elucidated, research with TAAR1 provides important methodological insights:

Species variations in amino acid sequences within transmembrane domains can produce dramatic differences in ligand potency, efficacy, and stereoselectivity. For example, with TAAR1, researchers observed significant species-dependent stereoselectivity with respect to isomers of amphetamine and methamphetamine .

To characterize these differences methodologically:

  • Perform concentration-response studies using standardized in vitro assays (e.g., cAMP accumulation assays) with Taar7c from multiple species (rat, mouse, human) under identical experimental conditions.

  • Test a panel of potential ligands, including endogenous trace amines and synthetic compounds, against each species variant.

  • Analyze sequence alignments focusing on transmembrane domains to identify variable residues that may account for pharmacological differences.

  • Conduct site-directed mutagenesis experiments to confirm the role of identified residues, particularly those in TM6 and TM7, as these regions have been implicated in species-specific responses for TAAR1 .

How does the signaling pathway activation profile of rat Taar7c compare with other TAAR family members?

The signaling pathway profile of rat Taar7c likely shares commonalities with other TAAR family members but may exhibit unique characteristics. Based on TAAR1 signaling studies, researchers investigating Taar7c should:

What are the most reliable functional assays for characterizing rat Taar7c activation and inhibition?

When designing functional assays for rat Taar7c characterization, researchers should consider the following methodological approaches:

Primary Assay Options:

  • cAMP Accumulation Assay: This has proven effective for characterizing TAAR1 and would likely be suitable for Taar7c. The approach involves measuring concentration-dependent accumulation of cAMP in cells expressing the receptor following ligand exposure. This methodology can determine potency (EC50) and efficacy of potential agonists .

  • CRE-Luciferase Reporter Gene Assay: For cases where direct cAMP measurement is challenging, a cAMP-dependent, CRE-promoter driven reporter system can serve as a downstream indicator of receptor activation. This approach was successfully used for human TAAR1 when stable expression was difficult to achieve .

Assay TypeAdvantagesLimitationsBest Application
Direct cAMP MeasurementQuantitative, rapid responseRequires specific antibodies or labeled compoundsDetailed pharmacological characterization
CRE-Luciferase ReporterAmplified signal, suitable for transient expressionIndirect measurement, longer assay timeInitial screening, difficult-to-express receptors
Calcium MobilizationReal-time kinetic dataMay require co-expression of promiscuous G proteinsSecondary confirmation of activity
β-Arrestin RecruitmentIdentifies biased ligandsMay underestimate partial agonistsAdvanced characterization of signaling bias

What controls and validation steps are necessary when establishing new cell lines expressing recombinant rat Taar7c?

Establishing and validating cell lines expressing recombinant rat Taar7c requires rigorous quality control measures:

  • Expression Verification: Confirm receptor expression using multiple techniques:

    • Western blotting with validated antibodies against Taar7c or epitope tags

    • Quantitative PCR to measure mRNA expression levels

    • Immunocytochemistry to assess subcellular localization and expression patterns

  • Functional Validation: Verify that the expressed receptor couples to expected signaling pathways:

    • Conduct dose-response studies with known TAAR agonists

    • Compare response profiles to endogenous trace amines like β-phenylethylamine (PEA) and para-tyramine (p-TYR)

    • Establish baseline parameters such as basal activity and maximum stimulation capacity

  • Critical Controls:

    • Include parental (non-transfected) cells in all experiments to identify non-specific effects

    • Employ positive controls (cells expressing well-characterized TAARs like TAAR1)

    • Incorporate negative controls (inactive compounds structurally related to TAAR agonists)

    • For transient transfections, include transfection efficiency controls

How should researchers approach the design of homology models for rat Taar7c structure-function studies?

Developing accurate homology models for rat Taar7c requires a systematic approach building on established GPCR modeling techniques:

  • Template Selection: The crystal structure of the β2-adrenergic receptor (β2AR) has proven useful for TAAR1 modeling and would likely serve as an appropriate template for Taar7c. When available, use multiple templates to improve model accuracy, particularly for regions with variable structural conservation .

  • Sequence Alignment Optimization: Carefully align Taar7c sequences with template structures, paying particular attention to conserved motifs in transmembrane domains. Manual refinement of alignments may be necessary, especially in loop regions where structural conservation is lower .

  • Model Building and Refinement:

    • Generate initial models using specialized software (e.g., Pymol, Modeller)

    • Refine models through energy minimization and molecular dynamics simulations

    • Validate models using Ramachandran plots and other structural validation tools

    • Identify putative ligand binding pockets, focusing on transmembrane domains 3, 6, and 7

  • Experimental Validation: Use site-directed mutagenesis to test predictions from the homology model, particularly regarding residues predicted to be involved in ligand binding. This iterative process of model prediction and experimental testing allows progressive refinement of structural understanding .

What statistical approaches are most appropriate for analyzing concentration-response data for rat Taar7c ligands?

When analyzing concentration-response data for rat Taar7c ligands, researchers should employ rigorous statistical approaches to ensure accurate interpretation:

  • Nonlinear Regression Analysis: Fit concentration-response data to appropriate mathematical models (typically sigmoidal dose-response curves) to determine key pharmacological parameters:

    • EC50/IC50 values (potency)

    • Emax values (efficacy)

    • Hill coefficients (cooperativity)

  • Model Selection: Compare different mathematical models (e.g., three-parameter vs. four-parameter logistic equations) using statistical criteria such as:

    • Akaike Information Criterion (AIC)

    • F-test for nested models

    • Residual analysis

  • Statistical Comparisons: When comparing parameters between different ligands or experimental conditions:

    • Use appropriate statistical tests (t-tests, ANOVA with post-hoc tests)

    • Report confidence intervals for key parameters

    • Consider using global fitting approaches when comparing multiple datasets

  • Data Normalization: When comparing results across experiments:

    • Normalize data to appropriate controls or standards

    • For Taar7c, consider normalizing responses to the maximum effect produced by a reference agonist such as β-phenylethylamine (PEA), similar to the PEAmax approach used in TAAR1 studies

How should researchers interpret and address apparent species differences in rat Taar7c pharmacology?

When investigating species differences in Taar7c pharmacology, researchers should implement a systematic interpretive framework:

  • Comprehensive Pharmacological Profiling: Generate complete concentration-response curves for multiple ligands across species variants (rat, mouse, human) under identical experimental conditions. Parameters to compare include:

    • Potency (EC50/IC50 values)

    • Efficacy (maximum responses)

    • Rank order of ligand potency

    • Stereoselectivity patterns

  • Sequence-Function Correlation: Analyze amino acid sequence differences between species, focusing on:

    • Transmembrane domains, particularly TM6 and TM7, which have been implicated in species differences for TAAR1

    • Extracellular loops that may influence ligand access

    • Intracellular regions that affect G-protein coupling

  • Mutagenesis Validation: Test hypotheses about the molecular basis of species differences through:

    • Single amino acid substitutions swapping residues between species

    • Creation of chimeric receptors

    • Evaluation of multiple parameters to comprehensively assess how mutations affect receptor function

  • Translational Implications: Consider how identified species differences might impact:

    • Interpretation of preclinical data from rodent models

    • Translation of findings to human receptors

    • Selection of appropriate model systems for specific research questions

What are the best practices for comparing novel ligands with endogenous activators of rat Taar7c?

When evaluating novel ligands against endogenous activators of rat Taar7c, researchers should follow these methodological best practices:

  • Reference Compound Selection: Establish reliable reference compounds:

    • Use well-characterized endogenous trace amines (β-phenylethylamine, para-tyramine) as primary reference standards

    • Include positive controls with established potency and efficacy profiles

    • Select references that produce robust, reproducible responses

  • Comprehensive Pharmacological Characterization:

    • Determine full concentration-response relationships rather than single-concentration comparisons

    • Assess multiple parameters (potency, efficacy, kinetics of response)

    • Evaluate potential antagonism or allosteric modulation properties

    • Test novel compounds in multiple functional assays to identify potential signaling bias

  • Data Normalization and Presentation:

    • Express responses relative to a defined maximum (e.g., response to a reference full agonist)

    • Present raw data alongside normalized results

    • Include concentration-response curves for reference compounds in each experiment

    • Report intrinsic activity values relative to endogenous agonists

  • Structure-Activity Relationship Analysis:

    • Systematically compare structural features of novel and endogenous ligands

    • Correlate structural modifications with changes in pharmacological parameters

    • Use computational approaches (docking studies, pharmacophore modeling) to predict binding modes

    • Validate predictions through strategic chemical modifications and mutagenesis studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.