Recombinant Rat Trace amine-associated receptor 7d (Taar7d)

Shipped with Ice Packs
In Stock

Description

Production and Purity

Taar7d is produced via recombinant expression systems, with protocols optimized for high yield and purity:

ParameterDetails
Host SystemsE. coli, yeast, baculovirus, or mammalian cells
Purity≥85% as determined by SDS-PAGE
Storage BufferTris-based buffer with 50% glycerol
Storage Conditions-20°C or -80°C; avoid repeated freeze-thaw cycles

Recombinant Taar7d is often expressed with an N-terminal His-tag to facilitate purification via nickel-affinity chromatography. Cell-free expression systems are also employed for rapid production .

Functional and Research Applications

While Taar7d’s endogenous ligands remain uncharacterized, its recombinant form is used in:

  • Ligand-Binding Studies: To identify trace amines or synthetic compounds that modulate TAAR activity.

  • ELISA Assays: Detection and quantification of Taar7d in biological samples .

  • Structural Analyses: Cryo-EM or X-ray crystallography to map binding pockets (though no Taar7d structures are currently published) .

Comparison with Other TAAR Subtypes
Taar7d shares limited sequence identity with TAAR1, which binds trace amines (e.g., β-phenylethylamine, tyramine) and psychostimulants (e.g., amphetamine) . Key differences include:

FeatureTaar7dTAAR1
Ligand SpecificityUnknownTrace amines, psychostimulants
Species ConservationRat-specific subfamilyConserved across mammals
Chromosomal LocationRat chromosome 1p12 Human chromosome 6q23.1

Research Challenges and Gaps

Current limitations in Taar7d research include:

  1. Limited Functional Data: No published studies on its agonists, antagonists, or downstream signaling pathways.

  2. Structural Uncertainty: No resolved crystal or cryo-EM structures, unlike TAAR1 .

  3. Species-Specific Roles: Potential differences in ligand binding compared to human or mouse TAAR subtypes .

Key Research Findings

  1. Sequence Homology: Taar7d belongs to a rat-specific cluster of TAAR genes, distinct from human/mouse TAAR1 .

  2. Production Efficiency: High-purity recombinant Taar7d can be achieved via E. coli expression, enabling downstream functional assays .

  3. Potential Applications: Use in screening platforms to identify novel TAAR modulators for neurological or metabolic disorders .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please specify your preference when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference point.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be decided during production. If you have a preferred tag type, please inform us, and we will prioritize developing it for your order.
Synonyms
Taar7d; Ta15; Tar15; Trar15; Trace amine-associated receptor 7d; TaR-7d; Trace amine receptor 7d; Trace amine receptor 15; TaR-15
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-358
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Taar7d
Target Protein Sequence
MRVDDDRFPWDQDSILSRDLLSASSLQLCYENLNRSCVRSPYSPGPRLILYAVFGFGAVL AVCGNLMVMTSILHFRQLHSPANFLVASLACADFLVGLTVMPFSMVRSVEGCWYFGDTYC KLHTCFDVSFCYCSLFHLCFISVDRYIAVSDPLIYPTRFTASVSGKCITFSWLLSIIYGF PLIYTGASEAGLEDLVSALTCVGGCQIPMNQKFVLINFLLFLVPTLVMMTVYSKIFLIAR QQAQNIEKMRKQTARASESYKDRVCKRERKAAKTLGIAVAAFLLSWLPYFIDSIIDAFLG FITPTYVYEILIWIVYYNSSMNPLIYAFFYPWFRKATKLIVTGKILRENSSTINLFPE
Uniprot No.

Target Background

Function
Trace amine-associated receptor 7d (Taar7d) is an orphan receptor that may function as a receptor for trace amines. Trace amines are biogenic amines found in very low concentrations in mammalian tissues. While some trace amines have well-defined roles as neurotransmitters in invertebrates, their function as true neurotransmitters in vertebrates remains speculative. Trace amines are likely involved in various physiological functions that require further investigation.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Taar7d and how does it relate to other TAARs?

Taar7d belongs to the Trace Amine-Associated Receptor family, which has been identified in the genome of every vertebrate species examined to date. While TAAR1 is the most extensively studied member of this family, Taar7d belongs to a subfamily that has evolved differently across species. TAARs are G protein-coupled receptors (GPCRs) that were originally investigated for their response to trace amines such as β-phenylethylamine, tyramine, and octopamine .

The TAAR family contains multiple subfamilies with distinct evolutionary histories and potentially different physiological roles. Unlike TAAR1, which responds to a variety of biogenic amines and amphetamine-like compounds, Taar7d's ligand profile and signaling pathways may exhibit significant differences that warrant specific experimental approaches.

What expression systems are most suitable for studying recombinant rat Taar7d?

Based on successful approaches with other TAARs, recombinant rat Taar7d can be heterologously expressed in several systems:

  • Xenopus laevis oocytes: These have been successfully used for functional expression of TAAR1 and offer advantages for electrophysiological studies .

  • Mammalian cell lines: HEK-293 cells have proven effective for expressing TAAR1 and would likely be suitable for Taar7d studies. Lower concentrations of ligands can often evoke measurable responses in these cells compared to other systems .

  • Stably transfected cell lines: For long-term studies, generating stably expressing cell lines offers more consistent receptor expression levels than transient transfection approaches .

When selecting an expression system, consider the following factors:

  • Endogenous expression of signaling machinery

  • Expected coupling mechanism (likely Gαs for cAMP production)

  • Specific experimental readouts planned

  • Need for post-translational modifications

How can I confirm successful expression of recombinant rat Taar7d?

Confirmation of successful expression requires multiple approaches:

  • Functional assays: Measure second messenger production (e.g., cAMP) in response to potential ligands. TAAR1 couples to stimulation of cAMP production when expressed in various cell lines , and Taar7d may utilize similar signaling pathways.

  • Immunological detection: Use epitope tags (e.g., HA, FLAG) if antibodies specific to Taar7d are unavailable.

  • Fluorescent protein fusion: Create Taar7d-GFP fusions to visualize expression and localization, though care must be taken to ensure the fusion doesn't impair function.

  • RNA verification: Confirm transcript expression using RT-PCR or RNA sequencing.

What approaches are most effective for structure-function studies of Taar7d?

Structure-function studies of Taar7d should build upon established methodologies used for other TAARs:

  • Site-directed mutagenesis: Target specific residues in transmembrane domains thought to be involved in ligand binding. Key considerations include:

    • Focus on transmembrane domains TM3, TM6, and TM7, which have been shown to be critical for TAAR1 function

    • The conserved aspartate D3.32 in TM3 is likely crucial for monoamine ligand binding due to the ionic interaction with the positively charged amino group of potential ligands

    • Residues aligning with N6.55 and N7.39 from β-adrenergic receptors may be important for ligand specificity

  • Chimeric receptors: Create chimeras between Taar7d and better-characterized TAARs to identify domains responsible for specific functions.

  • Molecular modeling: Develop computer-generated models of Taar7d based on crystal structures of related GPCRs (such as β2-adrenergic receptors) to guide mutagenesis studies .

  • Sequence comparison across species: Identify conserved and divergent residues that may contribute to species-specific responses, similar to the approach used for TAAR1 .

How should concentration-response experiments be designed for Taar7d ligand screening?

When designing concentration-response experiments for Taar7d:

  • Concentration range selection: Test a wide range of concentrations (typically 10⁻⁹ to 10⁻⁴ M) of potential ligands to establish full concentration-response curves.

  • Controls: Include:

    • Positive controls (known TAAR agonists like β-phenylethylamine)

    • Negative controls (vehicle and non-transfected cells)

    • Reference compounds with established potency at related receptors

  • Signaling pathway detection: Measure:

    • cAMP production (primary coupling expected for TAARs)

    • Alternative signaling pathways (calcium mobilization, ERK phosphorylation)

    • Receptor internalization or desensitization

  • Statistical analysis: Apply appropriate curve-fitting models to calculate:

    • EC₅₀ values (potency)

    • Emax values (efficacy)

    • Hill coefficients (cooperativity)

  • Replication requirements: Perform experiments in triplicate across at least three independent experiments to ensure reliability.

What methods can detect species-specific differences in Taar7d function?

Investigation of species differences in Taar7d should employ:

  • Comparative pharmacology: Test the same set of compounds across Taar7d from different species (rat, mouse, human) under identical experimental conditions.

  • Stereoselectivity analysis: Examine responses to stereoisomers of compounds (e.g., D- vs L-isomers) as these often reveal species-specific preferences, as seen with TAAR1 .

  • Sequence alignment and key residue identification: Identify amino acid differences in transmembrane domains between species that might account for functional differences .

  • Site-specific mutagenesis: Perform reciprocal mutations (e.g., mutating rat Taar7d to match mouse residues and vice versa) to determine if species-specific properties can be transferred, similar to approaches used for TAAR1 where single amino acid changes significantly altered stereoselectivity .

SpeciesKey SiteAmino AcidPotential Impact on Function
RatTM6.55M268*Ligand binding specificity
MouseTM6.55T268*Altered stereoselectivity
RatTM7.39N287*Species-specific ligand interactions
MouseTM7.39Y287*Different hydrogen-bonding properties

*Residue positions based on TAAR1 data; equivalent positions in Taar7d would need confirmation

How should I design experiments to characterize Taar7d signaling pathways?

Comprehensive characterization of Taar7d signaling requires a systematic experimental approach:

  • G protein coupling profile determination:

    • Measure cAMP production (Gαs coupling)

    • Assess calcium mobilization (potential Gαq coupling)

    • Examine inhibition of forskolin-stimulated cAMP (possible Gαi coupling)

    • Use G protein-selective inhibitors to confirm coupling mechanism

  • Signaling kinetics assessment:

    • Real-time measurements using BRET/FRET-based sensors

    • Time-course experiments to determine activation and desensitization rates

  • Arrestin recruitment and receptor internalization:

    • BRET/FRET-based arrestin recruitment assays

    • Immunofluorescence microscopy to track receptor localization

    • Flow cytometry to quantify surface expression changes

  • Downstream signaling pathways:

    • MAP kinase activation (ERK1/2 phosphorylation)

    • Transcription factor activation using reporter gene assays

    • Proteomic approaches to identify novel pathways

When establishing these methods, follow the research chain of reasoning approach that links research questions, methods, and analysis techniques in a coherent framework3.

What controls are essential for validating Taar7d mutagenesis studies?

Successful mutagenesis studies require rigorous controls:

  • Expression level controls:

    • Quantify receptor expression for wild-type and mutant constructs

    • Normalize functional responses to expression levels

    • Use epitope tags to verify equivalent surface expression

  • Functional controls:

    • Include known inactivating mutations (e.g., D3.32A) as negative controls

    • Test reference compounds with established activity

    • Include wild-type receptor in every experiment as a baseline

  • Structural integrity validation:

    • Test general GPCR agonists to confirm proper folding

    • Assess basal activity levels

    • Perform molecular modeling to predict effects of mutations

  • Compound purity verification:

    • Use analytical methods to confirm ligand purity

    • Test for potential metabolites that might have activity

How can I effectively analyze conflicting data from Taar7d experiments?

When encountering conflicting experimental results:

  • Systematic troubleshooting approach:

    • Verify receptor construct sequence and expression

    • Test multiple batches of compounds

    • Examine experimental conditions (temperature, buffers, cell passage)

  • Cross-validation with multiple assays:

    • Compare results between different functional assays

    • Use both transient and stable expression systems

    • Confirm key findings in different cell backgrounds

  • Statistical analysis:

    • Apply appropriate statistical tests to determine significance

    • Consider power analysis to ensure adequate sample size

    • Use Experimental Design methodology to systematically vary factors

  • Source of variability identification:

    • Isolate variables using factorial experimental designs

    • Test for time-dependent effects

    • Investigate potential signaling crosstalk

  • Independent verification:

    • Reproduce key findings with fresh reagents

    • Employ alternative techniques when possible

    • Consider blind experimental designs to eliminate bias

What statistical approaches are most appropriate for analyzing Taar7d pharmacological data?

Robust statistical analysis of Taar7d data should include:

  • Concentration-response analysis:

    • Non-linear regression using four-parameter logistic model

    • Calculation of EC₅₀/IC₅₀ values with 95% confidence intervals

    • Comparison of curves using extra sum-of-squares F test

  • Experimental design optimization:

    • Factorial designs to efficiently test multiple variables

    • Randomization of treatment order to minimize bias

    • Sample size determination via power analysis

  • Multiple comparison corrections:

    • Bonferroni or Holm-Sidak for planned comparisons

    • False discovery rate control for high-throughput screening

  • Multivariate analysis for complex datasets:

    • Principal component analysis for pattern recognition

    • Cluster analysis for grouping compounds with similar profiles

    • Machine learning approaches for predictive pharmacology

  • Data visualization techniques:

    • Heat maps for comparing multiple compounds across mutations

    • Radar plots for multiparameter pharmacological profiling

    • Forest plots for meta-analysis of multiple experiments

How can molecular modeling inform Taar7d experimental design?

Molecular modeling provides valuable insights for Taar7d research:

  • Homology model development:

    • Create models based on related GPCR crystal structures

    • Use TAAR1 models as templates when available

    • Refine models with molecular dynamics simulations

  • Virtual screening applications:

    • Identify potential ligands for experimental testing

    • Predict structure-activity relationships

    • Prioritize compounds for synthesis and evaluation

  • Binding pocket analysis:

    • Identify key residues for mutagenesis studies

    • Predict ligand binding modes

    • Compare binding sites across species to explain selectivity

  • Mutation effect prediction:

    • Simulate effects of point mutations on receptor structure

    • Predict changes in ligand binding energetics

    • Guide design of compensatory mutations

  • Integration with experimental data:

    • Iteratively refine models based on experimental results

    • Use experimental data to validate and improve models

    • Develop predictive models of receptor activation

What emerging technologies could advance Taar7d research?

Several cutting-edge approaches show promise for Taar7d investigation:

  • CRISPR/Cas9 genome editing:

    • Generate knockout/knockin cellular models

    • Create humanized animal models

    • Introduce mutations at endogenous loci

  • Cryo-EM for structural studies:

    • Determine Taar7d structure in different conformational states

    • Visualize ligand-receptor complexes

    • Resolve structures with different signaling partners

  • Single-cell analysis:

    • Examine heterogeneity in receptor expression

    • Correlate receptor levels with signaling responses

    • Identify rare responder populations

  • Computational approaches:

    • Machine learning for ligand discovery

    • Systems biology modeling of signaling networks

    • Quantum mechanics calculations for binding energy precision

  • Biosensor development:

    • FRET/BRET sensors for real-time conformational changes

    • Allosteric fluorescent reporters

    • Nanobody-based sensors for specific conformational states

How might findings from Taar7d research translate to understanding other TAARs?

Taar7d research has broader implications:

  • Evolutionary insights:

    • Comparative analysis across TAAR subtypes

    • Understanding selective pressures on different subfamilies

    • Reconstruction of ancestral receptors

  • Pharmacological principles:

    • Identification of conserved binding mechanisms

    • Development of subtype-selective compounds

    • Elucidation of allosteric modulation principles

  • Physiological role determination:

    • Correlation of signaling properties with in vivo function

    • Comparative tissue expression profiling

    • Integration with systems biology approaches

  • Translational applications:

    • Identification of potential therapeutic targets

    • Development of diagnostic tools

    • Understanding of receptor-related pathologies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.