Recombinant Rat Trace amine-associated receptor 7e (Taar7e)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Taar7e; Ta14; Tar14; Trar14; Trace amine-associated receptor 7e; TaR-7e; Trace amine receptor 7e; Trace amine receptor 14; TaR-14
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-358
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Taar7e
Target Protein Sequence
MATDDASFPWDQDSILSRDLLSALSSQLCYENLNRSCIRSPYSPGPRLILHAVFGFSAVL AVCGNLLVMTSILHFRQLHSPANFLVASLACADLLVGLTVMPFSMVRSVEGCWYFGDIYC KFHSSFDVSFCYSSIFHLCFISVDRYIAVSDPLIYLTRFTASVSGKCITFSWFLSIIYSF SLLYTGASEAGLEDLVSALTCVGGCQLAVNQSWVFINFLLFLVPTLVMMTVYSKVFLIAK QQAQNIEKIGKQTARASESYKDRVAKRERKAAKTLGITVAAFLLSWLPYFIDSIIDAFLG FITPTYVYEILVWIAYYNSAMNPLIYAFFYPWFRKAIKLIVTGKILRENSSATNLFPE
Uniprot No.

Target Background

Function

Trace amine-associated receptor 7e (TAAR7e) is an orphan receptor, potentially acting as a receptor for trace amines. Trace amines are biogenic amines found in low concentrations in mammalian tissues. While their neurotransmitter roles in invertebrates are well-defined, their function in vertebrates remains under investigation. Trace amines are likely involved in various, yet fully uncharacterized, physiological processes.

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Trace amine-associated receptor 7e and what is its significance in research?

Trace amine-associated receptor 7e (Taar7e) is a G protein-coupled receptor (GPCR) encoded by the Taar7e gene in rats (Rattus norvegicus). It is also known by alternative names including TaR-7e, Trace amine receptor 7e, Trace amine receptor 14, and TaR-14. The gene has several synonyms including Ta14, Tar14, and Trar14 .

Taar7e belongs to a family of receptors that respond to trace amines, which are endogenous compounds present at very low concentrations in mammalian tissues. The significance of Taar7e in research stems from its potential role in understanding neurological processes, pharmacological responses, and the broader functionality of the trace amine receptor family. The receptor consists of 358 amino acids and contains the characteristic TAAR family motif that overlaps with the seventh transmembrane domain, defined as NSXXNPXX[YH]XXX[YF]XWF .

How does Taar7e relate to other trace amine-associated receptors?

Taar7e is part of a larger family of trace amine-associated receptors. Comparative genomic analyses have revealed that TAARs form a distinct GPCR family with unique conserved features. Studies by Borowsky et al. (2001) identified 15 sequences with high homology to each other in this family. Within these sequences, 74 amino-acid residues are completely conserved across all 15 genes, with 52 of these residues being unique to this GPCR family .

These conserved residues are distributed throughout the receptor molecule, particularly within the seven transmembrane segments. The relationships between different TAARs have been extensively mapped through genomic sequencing efforts by Lindemann et al. (2005) and Gloriam et al. (2005), who assembled comprehensive catalogs of all trace amine receptor genes across multiple vertebrate and invertebrate species .

What experimental designs are most effective for studying Taar7e receptor pharmacology?

When designing experiments to study Taar7e receptor pharmacology, researchers should consider implementing a randomized block design (RBD) when multiple variables need to be controlled. This approach is particularly valuable when examining ligand binding or signaling properties across different experimental conditions.

An effective experimental design for Taar7e pharmacology studies should include:

  • Controlled expression systems: Heterologous expression in HEK cells, following the methodology of Bunzow et al. (2001), who successfully characterized the cloned rat trace amine receptor in this system .

  • Randomized block design: When testing multiple ligands or conditions, organize experimental units into homogeneous blocks where each treatment (ligand concentration, antagonist, etc.) appears once per block. This reduces error variance by accounting for block-to-block variation .

  • Dose-response relationships: Implement a factorial design that examines multiple concentrations of potential ligands to establish EC50 values and efficacy parameters.

The statistical model for such experiments can be represented as:

yij=μ+αi+βj+εijy_{ij} = \mu + \alpha_i + \beta_j + \varepsilon_{ij}

How can researchers optimize expression and purification of recombinant Taar7e for structural studies?

Optimizing expression and purification of recombinant Taar7e presents significant challenges due to the hydrophobic nature of membrane proteins. Based on established protocols for similar GPCRs, the following methodological approach is recommended:

  • Expression system selection:

    • For mammalian expression: Use HEK293 cells with inducible expression systems

    • For insect cell expression: Baculovirus expression system with Sf9 or High Five cells

    • Consider fusion partners (T4 lysozyme or thermostabilized apocytochrome b562) to increase stability

  • Solubilization optimization:

    • Test multiple detergents including n-dodecyl-β-D-maltopyranoside (DDM), lauryl maltose neopentyl glycol (LMNG), or digitonin

    • Implement a systematic screening of detergent combinations at various concentrations

  • Purification strategy:

    • Initial capture using affinity chromatography (Immobilized metal affinity chromatography with His-tag)

    • Secondary purification using size exclusion chromatography

    • Consider lipid nanodisc reconstitution for maintaining native-like environment

  • Storage conditions:

    • Follow established guidelines for Taar7e which recommend storage at -20°C, or at -80°C for extended periods

    • Maintain in buffer containing 50% glycerol to prevent degradation

  • Quality control:

    • Confirm proper folding using circular dichroism spectroscopy

    • Verify functionality through ligand binding assays

    • Assess homogeneity by analytical ultracentrifugation

What are the current challenges in differentiating the functions of Taar7e from other closely related TAARs?

Differentiating the functions of Taar7e from other closely related TAARs presents several methodological challenges:

  • Sequence homology complexity: The high degree of sequence similarity between TAARs (with 74 amino acid residues completely conserved across 15 genes) makes selective targeting difficult . This necessitates precision in experimental design when attempting to isolate Taar7e-specific functions.

  • Overlapping ligand selectivity: TAARs often exhibit overlapping ligand preferences, making pharmacological differentiation challenging. Researchers must develop highly selective agonists and antagonists.

  • Methodological approaches to address these challenges:

    a) CRISPR/Cas9 gene editing: Create selective Taar7e knockout models while preserving other TAARs

    b) Chimeric receptor approach: Generate chimeric receptors between Taar7e and other TAARs to identify domains responsible for specific functions

    c) Computational modeling: Employ machine learning algorithms to predict ligand-binding differences based on the 52 unique residues specific to the TAAR family

    d) Single-cell transcriptomics: Map expression patterns in specific tissues to identify unique cellular contexts for Taar7e

  • Analytical validation: Implement multiple orthogonal techniques to confirm Taar7e-specific findings, including:

    • Radioligand binding assays with selective compounds

    • BRET/FRET-based signaling assays

    • Immunocytochemistry with validated antibodies

    • Advanced imaging techniques for localization studies

How should researchers design dose-response experiments for Taar7e ligands?

When designing dose-response experiments for Taar7e ligands, researchers should implement a systematic approach that accounts for both statistical power and biological relevance:

  • Experimental design framework:

    • Implement a Complete Randomized Design (CRD) with multiple replicates per concentration

    • For cell-based assays, use at least 3-4 biological replicates and 2-3 technical replicates per condition

    • Include appropriate positive controls (known TAAR ligands) and negative controls

  • Concentration range determination:

    • Use logarithmic dilution series spanning at least 5-6 log units (e.g., 10^-10 to 10^-5 M)

    • Include sufficient data points around the anticipated EC50 value

    • The standard curve should include at least 8-10 concentration points

  • Data analysis approach:

    • Fit dose-response data to appropriate models (four-parameter logistic equation):
      Y=Bottom+TopBottom1+10(LogEC50X)×HillSlopeY = Bottom + \frac{Top - Bottom}{1 + 10^{(LogEC50 - X) \times HillSlope}}

    • Calculate key pharmacological parameters:

      • EC50/IC50 values

      • Efficacy (Emax)

      • Hill coefficient

  • Statistical considerations:

    • Power analysis to determine minimum sample size

    • Use ANOVA with post-hoc tests for comparing responses across concentrations

    • Implementation of appropriate normalization methods for plate-to-plate variability

What factors should be controlled when comparing wild-type and mutant Taar7e variants?

  • Expression level normalization:

    • Quantify surface expression using flow cytometry or cell-surface ELISA

    • Implement inducible expression systems to achieve comparable protein levels

    • Correct functional data for expression differences using the following formula:
      Normalized_Response=Measured_ResponseRelative_Expression_LevelNormalized\_Response = \frac{Measured\_Response}{Relative\_Expression\_Level}

  • Experimental design recommendations:

    • Use Randomized Block Design (RBD) where each block contains both wild-type and all mutant variants

    • Include repeated measures across multiple experimental days

    • Blind the experimenter to sample identity when possible

  • Control variables:

    • Maintain consistent cell passage numbers (±1-2 passages)

    • Standardize transfection efficiency using co-expressed reporter genes

    • Control for differences in cell health using viability assays

    • Maintain consistent incubation times and temperatures

  • Analytical considerations:

    • Statistical comparison using two-way ANOVA with receptor type and experimental condition as factors

    • Post-hoc analysis with correction for multiple comparisons

    • Calculate fold-changes relative to wild-type response

How can competitive binding assays be optimized for Taar7e research?

Optimizing competitive binding assays for Taar7e research requires careful consideration of receptor properties, ligand characteristics, and experimental conditions:

  • Radioligand selection criteria:

    • High specific activity (>30 Ci/mmol)

    • Acceptable affinity (Kd < 10 nM)

    • Minimal non-specific binding

    • Chemical stability under assay conditions

  • Assay optimization protocol:

    • Determine optimal protein concentration through saturation binding

    • Establish equilibration time through association kinetics experiments

    • Optimize separation technique (filtration vs. centrifugation)

    • Validate signal-to-background ratio (aim for >10:1)

  • Experimental design implementation:

    • Use Completely Randomized Design (CRD) with equal replication across treatments

    • Include at least 8-10 competitor concentrations spanning 5-6 log units

    • Run at least three independent experiments with duplicate or triplicate samples

  • Data analysis framework:

    • Apply the Cheng-Prusoff equation to convert IC50 to Ki:
      Ki=IC501+[L]KdK_i = \frac{IC_{50}}{1 + \frac{[L]}{K_d}}

    • Analyze competition curves for evidence of multiple binding sites

    • Use statistical comparisons (ANOVA) to compare Ki values between compounds

How should researchers interpret contradictory results between in vitro and in vivo Taar7e studies?

When faced with contradictory results between in vitro and in vivo Taar7e studies, researchers should implement a systematic analytical framework:

  • Methodological reconciliation approach:

    • Evaluate differences in experimental design between studies

    • Consider the complexity of in vivo systems versus reductionist in vitro approaches

    • Assess whether contradictions are quantitative (magnitude) or qualitative (direction)

  • Potential sources of discrepancy:

    • System complexity: In vivo studies include additional regulatory mechanisms

    • Receptor coupling efficiency: Cell lines may express different G-protein subunits than native tissues

    • Pharmacokinetic factors: In vivo drug distribution, metabolism, and clearance

    • Compensatory mechanisms: Potential redundancy with other TAARs in vivo

  • Resolution strategies:

    • Conduct intermediate complexity studies (ex vivo tissue preparations, organoids)

    • Manipulate specific variables systematically to identify discrepancy sources

    • Implement advanced statistical modeling to reconcile datasets:
      Combined_Effect=β1(in_vitro_effect)+β2(in_vivo_effect)+εCombined\_Effect = \beta_1(in\_vitro\_effect) + \beta_2(in\_vivo\_effect) + \varepsilon

  • Reporting recommendations:

    • Present both datasets with transparent discussion of limitations

    • Consider developing a standardized framework for evidence evaluation

    • Suggest mechanistic hypotheses that could explain observed discrepancies

What statistical approaches are most appropriate for analyzing Taar7e signaling pathway data?

The analysis of Taar7e signaling pathway data requires sophisticated statistical approaches that can account for the complexity and variability inherent in signaling cascades:

How can researchers effectively compare Taar7e functionality across different species?

Conducting cross-species comparisons of Taar7e functionality requires careful consideration of evolutionary relationships, methodological standardization, and appropriate analytical frameworks:

  • Experimental design considerations:

    • Use Latin square design when comparing multiple species and multiple ligands to control for order effects

    • Implement systematic controls for species-specific factors (membrane composition, cellular environments)

    • Standardize expression levels across species orthologs

  • Analytical framework:

    • Sequence-function correlation analysis:

      • Align sequences to identify conserved versus variable regions

      • Map functional differences to sequence variations

      • Focus particularly on the 52 residues unique to the TAAR family

    • Phylogenetic correction in statistical analyses:

      • Account for evolutionary relationships when comparing functional parameters

      • Implement phylogenetic comparative methods (independent contrasts)

  • Data normalization approaches:

    • Internal standardization using reference compounds

    • Calculation of relative efficacy and potency metrics:
      Relative_Efficacy=Emax(species_variant)Emax(reference_species)Relative\_Efficacy = \frac{E_{max}(species\_variant)}{E_{max}(reference\_species)}

  • Visualization and interpretation:

    • Radar plots for multiparameter comparison across species

    • Heatmaps clustered by functional similarity rather than phylogenetic relationship

    • Decision trees for identifying key determinants of species differences

What emerging technologies will advance Taar7e research in the next decade?

The study of Recombinant Rat Trace amine-associated receptor 7e (Taar7e) is poised to benefit from several emerging technologies that will significantly enhance our understanding of this receptor:

  • Cryo-electron microscopy advancements:

    • Single-particle cryo-EM for resolving Taar7e structure at near-atomic resolution

    • Time-resolved cryo-EM to capture conformational changes during activation

    • These approaches will build upon existing knowledge of the conserved motifs in the transmembrane domains

  • Computational and AI-based approaches:

    • Deep learning for predicting ligand-receptor interactions

    • Molecular dynamics simulations to model receptor dynamics

    • Virtual screening of novel ligands based on the unique 52 amino acid residues specific to the TAAR family

  • Advanced genetic tools:

    • CRISPR-based knock-in reporters to monitor endogenous Taar7e expression

    • Optogenetic and chemogenetic tools for precise temporal control of Taar7e activity

    • Single-cell transcriptomics to map Taar7e expression networks

  • Novel protein engineering strategies:

    • Nanobody development for stabilizing specific Taar7e conformations

    • Biosensor development for real-time monitoring of Taar7e activation in living cells

    • Protein design approaches to create selective Taar7e modulators

How might understanding Taar7e function contribute to broader neuroscience research?

Understanding Taar7e function has significant implications for broader neuroscience research, potentially contributing to several key areas:

  • Neuronal signaling mechanisms:

    • Elucidation of trace amine signaling pathways complementary to classical neurotransmission

    • Potential cross-talk with other neurotransmitter systems

    • Investigation of Taar7e's role in modulating neuronal excitability

  • Neuropsychiatric disorder models:

    • Exploration of Taar7e's potential role in conditions associated with altered trace amine levels

    • Development of selective tools for manipulating Taar7e function in behavioral models

    • Comparative studies between human and rat TAARs to establish translational relevance

  • Neuroimmune interactions:

    • Investigation of Taar7e expression in immune cells within the nervous system

    • Potential role in neuroinflammatory responses

    • Cross-talk between trace amine signaling and immune function

  • Methodological contributions:

    • Establishment of experimental paradigms applicable to other GPCR systems

    • Development of analytical frameworks for receptor-ligand interactions

    • Advancement of comparative pharmacology approaches

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.