Recombinant Rat Trace amine-associated receptor 7g (Taar7g)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery timelines, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Taar7g; Ta9; Tar9; Trar9; Trace amine-associated receptor 7g; TaR-7g; Trace amine receptor 7g; Trace amine receptor 9; TaR-9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-358
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Taar7g
Target Protein Sequence
MATDDGSFPWTQESILSRDLLSALSPQLCYENLNRSCVRSPYSPGSRLILYAVFGFGAVL AVCGNLLVMTSILHFRQLHSPANFLVASLACADLLVGLTVMPFSMVRSVEGCWYFGDSYC KLHSCFDISFCSSSLLHLCFISVDRHIAVSDPLIYPTRFTASVSGKYITFSWLLSIIYGF SLIYTGASEAGLEDLVSALTCVGGCQVAVNQSWVFINFLLFLVPALVMMTVYSKIFLIAK QQAQNMEKMSKQTARASDSYKDRVAKRERKAAKTLGIAVAAFLLSWLPYFVDSIIDAFLG FITPTYVYEILAWIAYYNSAMNPLIYAFFYPWFRKAIKLIVTGKILKENSSTINLFPE
Uniprot No.

Target Background

Function
Trace amine-associated receptor 7g (Taar7g) is an orphan receptor that may serve as a receptor for trace amines. Trace amines are biogenic amines found in very low levels in mammalian tissues. While some trace amines have well-defined roles as neurotransmitters in invertebrates, their function as true neurotransmitters in vertebrates remains speculative. Trace amines are likely involved in various physiological functions that require further investigation.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Rat Trace amine-associated receptor 7g (Taar7g)?

Recombinant Rat Trace amine-associated receptor 7g (Taar7g) is a G-protein coupled receptor expressed in various tissues including the olfactory epithelium in rats. It is encoded by the Taar7g gene (also known as Ta9, Tar9, or Trar9) and consists of 358 amino acids forming a typical seven-transmembrane domain structure characteristic of G-protein coupled receptors. The protein's UniProt accession number is Q923Y1, and it functions primarily in the detection of trace amines and related compounds. Recombinant Taar7g is the artificially expressed and purified form of this protein, typically produced in expression systems such as HEK293 cells, which allows for controlled study of the receptor's properties outside its native cellular environment .

How does Taar7g differ from other Trace amine-associated receptors?

Taar7g belongs to the larger family of Trace amine-associated receptors (TAARs) but exhibits distinct structural and functional characteristics. Unlike TAAR1, which has been extensively studied for its roles in cognitive function and neurotransmitter modulation, Taar7g shows more specialized functions in olfactory signaling. The receptor demonstrates unique ligand binding preferences compared to other TAARs, with specific amino acid sequences in its transmembrane domains conferring selectivity for particular amine compounds. While TAAR1 is widely expressed in central nervous system regions including the ventral tegmental area (VTA) and dorsal raphe nucleus, Taar7g expression is more restricted, primarily found in olfactory neurons and select peripheral tissues. These differences translate to varied physiological roles, with Taar7g functioning primarily in chemosensation rather than the broader neuromodulatory effects observed with receptors like TAAR1 .

What are the primary experimental models for studying Taar7g function?

The primary experimental models for studying Taar7g function include:

  • In vitro cell expression systems: HEK293 cells transfected with the Taar7g gene provide a controlled environment for studying receptor binding, signaling, and pharmacological properties. This approach allows for isolation of receptor-specific responses without confounding factors from other cellular components .

  • Primary olfactory neuron cultures: Isolated from rat nasal epithelium, these cultures maintain the native cellular environment of Taar7g, enabling studies on receptor trafficking, localization, and signaling in physiologically relevant conditions.

  • Transgenic rodent models: Including Taar7g knockout or overexpression models that help determine the in vivo functions of the receptor. Unlike TAAR1-KO mice, which have been extensively characterized for cognitive and behavioral phenotypes, Taar7g-specific genetic models are less reported in the literature but would provide valuable insights into this receptor's unique functions .

  • Electrophysiological approaches: Patch-clamp recordings of cells expressing Taar7g can measure direct receptor activation in response to ligands, offering temporal resolution of signaling events.

Each model offers distinct advantages depending on the research question, with in vitro systems providing mechanistic insights and in vivo models revealing physiological relevance.

What are the optimal conditions for expressing and purifying recombinant Taar7g?

The optimal conditions for expressing and purifying recombinant Taar7g involve several critical parameters:

Expression System Selection:

  • Mammalian cell lines (particularly HEK293) provide proper post-translational modifications and membrane insertion

  • Insect cell systems (Sf9 or High Five) offer higher protein yields while maintaining most mammalian-like modifications

  • E. coli systems are generally less suitable due to lack of appropriate folding machinery for GPCRs

Expression Protocol:

  • Gene optimization: Codon optimization for the host system improves expression efficiency

  • Vector selection: Vectors containing strong promoters (CMV for mammalian cells) and appropriate secretion signals

  • Temperature modulation: Reduced temperature (30-32°C) during induction phase improves proper folding

  • Addition of stabilizing agents: Cholesterol and specific lipids in culture media enhance receptor stability

Purification Strategy:

  • Solubilization: Use of mild detergents (DDM, LMNG) at concentrations just above CMC to extract receptors while maintaining native conformation

  • Affinity chromatography: Utilizing tags such as His6 or FLAG with appropriate buffer conditions (pH 7.4, 150mM NaCl)

  • Size exclusion chromatography: For removing aggregates and ensuring monodisperse preparations

  • Storage in stabilized buffer containing 50% glycerol at -20°C to -80°C to maintain functionality

The receptor should be maintained in Tris-based buffer with 50% glycerol as indicated by established protocols for optimal stability. Repeated freeze-thaw cycles should be avoided, with working aliquots stored at 4°C for up to one week to preserve activity .

How can researchers effectively design experiments to study Taar7g signaling pathways?

Designing effective experiments to study Taar7g signaling pathways requires a systematic approach incorporating multiple complementary techniques:

Experimental Design Framework:

  • Receptor Activation Assays:

    • cAMP accumulation assays using ELISA or FRET-based sensors to measure Gs coupling

    • Calcium mobilization assays with fluorescent indicators (Fluo-4) for Gq pathway assessment

    • BRET/FRET-based assays to measure direct G-protein coupling and β-arrestin recruitment

  • Signaling Pathway Validation:

    • Selective pathway inhibitors to confirm involvement (e.g., PKA inhibitors for cAMP pathways)

    • siRNA knockdown of pathway components to establish necessity

    • Phosphorylation-specific antibodies to monitor downstream effector activation

  • Temporal Resolution Studies:

    • Real-time measurement systems to capture signaling kinetics

    • Pulse-chase experiments to determine receptor internalization and recycling rates

    • Washout studies to assess signal persistence and termination

  • Controls and Validation:

    • Include TAAR1 as a positive control receptor with established signaling properties

    • Use both knockout systems and pharmacological blockade to confirm specificity

    • Include receptor-negative cells to establish background signal thresholds

  • Data Collection Parameters:

    • Establish dose-response relationships with multiple concentrations

    • Include appropriate time points (immediate, short-term, long-term)

    • Measure multiple pathway outputs to detect signaling bias

This methodological framework helps ensure comprehensive characterization of Taar7g signaling, enabling researchers to distinguish its unique properties from other TAAR family members and identify potential physiological roles.

What methodological approaches are recommended for generating reliable Taar7g binding assays?

Developing reliable binding assays for Taar7g requires careful consideration of assay formats, detection methods, and control measures to ensure specificity and reproducibility:

Recommended Methodological Approaches:

  • Radioligand Binding Assays:

    • Develop tritiated or iodinated ligands with confirmed specificity for Taar7g

    • Establish saturation binding protocols with Scatchard analysis to determine Kd and Bmax

    • Perform competition binding with unlabeled compounds to determine relative affinities

    • Utilize filtration techniques optimized for membrane-bound receptors

  • Fluorescence-Based Alternatives:

    • Time-resolved FRET (TR-FRET) assays using labeled receptor and ligand pairs

    • Fluorescence polarization assays for smaller molecular weight ligands

    • Bioluminescence resonance energy transfer (BRET) approaches for ligand-induced conformational changes

  • Surface Plasmon Resonance (SPR):

    • Immobilize purified Taar7g on sensor chips with controlled orientation

    • Measure real-time binding kinetics (kon and koff) for comprehensive affinity assessment

    • Evaluate temperature and buffer dependence of binding interactions

  • Assay Validation Parameters:

    • Determine Z' factor values >0.5 to confirm assay robustness

    • Establish intra- and inter-assay coefficients of variation <15%

    • Include positive controls with known binding properties

    • Evaluate non-specific binding with excess unlabeled competitor

  • Data Processing Considerations:

    • Apply appropriate mathematical models (one-site, two-site, allosteric)

    • Use global fitting approaches when analyzing complex binding mechanisms

    • Account for ligand depletion in high-affinity systems

These methodologies should be validated against established TAAR family members like TAAR1, for which selective ligands like RO5263397 have confirmed high affinities across species (mouse, rat, and human variants) . The high selectivity of such reference compounds provides benchmarks for evaluating Taar7g-specific interactions.

How can Taar7g be utilized in cognitive research models?

Taar7g represents a potentially valuable target for cognitive research, particularly when considered alongside the established cognitive effects of related receptors like TAAR1. Based on current research findings, the following methodological approaches can be employed:

Integration into Cognitive Research Models:

  • Novel Object Recognition (NOR) Paradigms:

    • Utilize the established NOR protocols similar to those validated with TAAR1 agonists

    • Incorporate training periods (10 min), short-term (20 min) and long-term (24h) retention tests

    • Analyze Taar7g's potential role in memory encoding versus retrieval by administering selective agonists/antagonists at different experimental phases

    • Compare performance between wildtype and knockout models to establish necessity for memory processes

  • Molecular and Cellular Correlates:

    • Examine neuroplasticity markers (BDNF, PSD-95, dendritic spine morphology) following Taar7g modulation

    • Investigate electrophysiological parameters (LTP, LTD) in memory-relevant brain structures

    • Apply in vivo microdialysis to measure neurotransmitter release patterns during cognitive tasks

  • Comparative Receptor Studies:

    • Establish parallel experiments with TAAR1 and Taar7g modulators to identify distinct versus overlapping cognitive functions

    • Utilize compound RO5263397 as a reference TAAR1 agonist to benchmark Taar7g-specific compounds

    • Develop dual-targeting approaches to evaluate potential synergistic effects

  • Translational Considerations:

    • Apply models relevant to cognitive disorders (schizophrenia models, stress paradigms)

    • Assess potential for reversing cognitive deficits in disease models

    • Evaluate species differences in receptor distribution and function when extrapolating to higher organisms

Research indicates that while TAAR1 activation by RO5263397 significantly enhances novel object recognition memory retrieval, careful investigation is needed to determine whether Taar7g modulation produces similar cognitive enhancements or operates through distinct mechanisms .

What are the challenges in developing selective ligands for Taar7g research?

Developing selective ligands for Taar7g presents several significant challenges that researchers must address through systematic approaches:

Key Challenges and Methodological Solutions:

  • Structural Homology Within TAAR Family:

    • Taar7g shares considerable sequence similarity with other TAAR subtypes, particularly in transmembrane domains

    • Solution Approach: Employ computational modeling including homology modeling, molecular dynamics simulations, and virtual screening to identify unique binding pockets

    • Validation Method: Conduct site-directed mutagenesis of predicted selectivity-determining residues to confirm computational models

  • Limited Pharmacological Tools:

    • Unlike TAAR1, which has well-characterized ligands like RO5263397, selective Taar7g ligands remain underdeveloped

    • Solution Approach: Implement high-throughput screening of diverse chemical libraries against purified Taar7g

    • Validation Method: Counter-screen hit compounds against all TAAR subtypes to establish selectivity profiles

  • Complex Receptor Conformational States:

    • GPCRs like Taar7g exhibit multiple active and inactive conformations

    • Solution Approach: Develop conformation-specific antibodies or nanobodies to stabilize and study discrete receptor states

    • Validation Method: Conduct biophysical characterization (HDX-MS, NMR) of ligand-induced conformational changes

  • Species Differences in Pharmacology:

    • Rat Taar7g may differ substantially from mouse or human orthologs

    • Solution Approach: Generate species-specific binding profiles for lead compounds

    • Validation Method: Develop humanized rat models expressing human TAAR variants for translational validation

  • Assay Development Challenges:

    • Establishing reliable functional readouts specific to Taar7g activation

    • Solution Approach: Implement multiplexed signaling assays measuring diverse pathways simultaneously

    • Validation Method: Confirm pathway engagement through independent techniques (phosphoproteomics, transcriptomics)

The selective TAAR1 partial agonist RO5263397 provides a valuable template for developing Taar7g-selective compounds, as it demonstrates high selectivity for TAAR1 across multiple species while maintaining low affinity for other receptors . Similar medicinal chemistry approaches, combined with structural biology insights, will be essential for developing the selective tools needed for definitive Taar7g research.

How can researchers integrate Taar7g studies with broader neurotransmitter systems research?

Integrating Taar7g research with broader neurotransmitter systems requires multidisciplinary approaches that examine interactions, overlapping signaling pathways, and functional consequences:

Integration Methodologies:

  • Co-expression Mapping and Interaction Studies:

    • Perform detailed immunohistochemical and in situ hybridization studies to map Taar7g expression relative to major neurotransmitter receptors

    • Develop proximity ligation assays (PLA) to detect direct protein-protein interactions between Taar7g and other neurotransmitter receptors

    • Utilize FRET/BRET techniques to evaluate potential heterodimerization with dopamine, serotonin, or glutamate receptors in real-time

  • Electrophysiological Integration Approaches:

    • Conduct patch-clamp recordings in neurons expressing Taar7g to evaluate modulation of synaptic transmission

    • Compare electrophysiological effects with established TAAR1 actions on VTA dopamine and DRN serotonin neurons

    • Perform multi-electrode array recordings to assess network-level consequences of Taar7g activation

  • Neurochemical Interaction Analysis:

    • Implement microdialysis studies to measure neurotransmitter release following Taar7g modulation

    • Develop PET imaging ligands for Taar7g to correlate receptor occupancy with neurotransmitter dynamics in vivo

    • Compare neurochemical signatures with those observed following TAAR1 activation

  • Behavioral Pharmacology Integration:

    • Design factorial experimental designs combining Taar7g ligands with selective modulators of dopamine, serotonin, and glutamate systems

    • Analyze behavioral readouts relevant to cognitive function, sensorimotor gating, and reward processing

    • Apply isobolographic analysis to determine synergistic, additive, or antagonistic interactions

  • Translational Integration Models:

    • Develop conditional knockout models allowing tissue-specific and temporally controlled Taar7g deletion

    • Compare phenotypes with established TAAR1-KO models, which show altered sensorimotor gating and perseverative behaviors

    • Evaluate potential for Taar7g-targeted interventions in models of psychiatric disorders

This integrated approach allows researchers to position Taar7g within the broader context of established neurotransmitter systems, potentially identifying novel therapeutic opportunities similar to those being explored with TAAR1, which has shown promise in cognitive enhancement and ameliorating schizophrenia symptoms .

What statistical approaches are most appropriate for analyzing Taar7g experimental data?

Statistical Analysis Framework for Taar7g Studies:

  • Binding Assay Analysis:

    • Non-linear regression for fitting saturation binding curves and calculating Kd and Bmax parameters

    • One-site vs. two-site binding models comparison using F-test to detect potential binding site heterogeneity

    • Cheng-Prusoff equation application for converting IC50 values from competition assays to Ki values

    • Analysis of variance components to determine assay reproducibility and reliability

  • Functional Response Analysis:

    • Four-parameter logistic regression for dose-response curves to determine EC50/IC50 values and efficacy parameters

    • Operational model fitting to distinguish affinity from efficacy components

    • Bias factor calculations when comparing multiple signaling pathways

    • Time-course modeling using area-under-curve or response kinetics parameters

  • In Vivo Behavioral Data Analysis:

    • Two-way ANOVA with factors including Genotype (WT vs. knockout) and Treatment (vehicle vs. compound)

    • Appropriate post-hoc tests (e.g., Tukey's or Bonferroni) for multiple comparisons

    • Repeated measures designs for longitudinal behavioral assessments

    • Sample size determination based on power analysis with effect sizes derived from TAAR1 studies

  • Advanced Computational Approaches:

    • Principal component analysis for multiparameter phenotypic data

    • Hierarchical clustering to identify compound or mutation similarities

    • Machine learning classification of compound activities or receptor conformations

    • Network analysis for pathway integration studies

From the literature, studies examining TAAR1 activation effects utilized two-way ANOVA revealing significant main effects of Treatment (F1,40 = 4.76, P < 0.05) and Genotype × Treatment interactions (F1,31 = 7.01, P < 0.05), followed by appropriate post-hoc analyses to determine specific group differences . Similar rigorous statistical approaches should be applied to Taar7g research.

How should researchers interpret contradictory data in Taar7g signaling studies?

Contradictory data is common in complex receptor signaling studies. Researchers investigating Taar7g should implement a systematic framework for addressing and interpreting seemingly conflicting results:

Methodological Framework for Resolving Data Contradictions:

  • Technical Variation Assessment:

    • Evaluate methodological differences between contradictory studies (cell types, assay formats, detection methods)

    • Implement standardized positive controls (such as known TAAR1 agonists like RO5263397) across experiments

    • Conduct interlaboratory validation studies with consistent protocols

    • Perform statistical meta-analysis when multiple datasets are available

  • Biological Mechanism Reconciliation:

    • Consider receptor conformational heterogeneity as a source of divergent signaling outcomes

    • Evaluate potential for biased agonism (differential pathway activation) explaining apparent contradictions

    • Assess cell-type specific signaling components that might alter response patterns

    • Investigate time-dependent effects that could explain different observation windows

  • Experimental Design Refinement:

    • Develop comprehensive concentration-response relationships rather than single-dose comparisons

    • Implement time-course studies to capture complete response dynamics

    • Utilize genetic approaches (CRISPR knockout/knockin) alongside pharmacological tools

    • Employ multiple orthogonal techniques to measure the same biological endpoint

  • Reporting and Analysis Transparency:

    • Document all experimental conditions completely, including passage number, transfection efficiency, and reagent sources

    • Report negative and null results alongside positive findings

    • Provide raw data and analysis scripts when possible

    • Consider pre-registration of study designs for hypothesis-driven research

  • Resolving Specific Contradiction Types:

    • Potency discrepancies: Standardize receptor expression levels and evaluate system coupling efficiency

    • Efficacy differences: Compare to reference full agonists and examine receptor reserve effects

    • Pathway selectivity conflicts: Ensure equivalent receptor expression across pathway studies

    • In vivo vs. in vitro disconnects: Consider pharmacokinetics, tissue penetration, and compensatory mechanisms

This structured approach recognizes that contradictions often reflect biological complexity rather than experimental error, particularly with GPCRs like Taar7g that may signal through multiple pathways with varying efficiencies.

What benchmarks should be used to evaluate the quality of Taar7g experimental data?

Establishing clear quality benchmarks for Taar7g experimental data ensures reliability, reproducibility, and meaningful interpretation. Researchers should implement the following quality control framework:

Quality Benchmarks for Taar7g Experimental Data:

Research involving related receptors like TAAR1 has established precedents for quality benchmarks, including demonstrating compound selectivity across species (mouse, rat, and human receptors) and validating effects through knockout models . Similar rigorous validation should be applied to Taar7g research.

What are the emerging applications of Taar7g in neuroscience research?

Taar7g research is positioned at the intersection of several exciting neuroscience frontiers, with emerging applications that extend beyond traditional receptor pharmacology:

Emerging Taar7g Applications in Neuroscience:

  • Olfactory System Processing and Behavior:

    • Investigation of Taar7g's role in detecting specific environmental amines relevant to social behaviors

    • Analysis of neural circuit activation patterns triggered by Taar7g-mediated olfactory inputs

    • Development of optogenetic and chemogenetic tools to selectively activate Taar7g-expressing neurons

    • Comparative analysis with other TAAR family members to create a comprehensive map of amine detection systems

  • Cognitive Enhancement Strategies:

    • Building on findings from TAAR1 research showing cognitive enhancement with selective agonists like RO5263397

    • Exploring potential synergistic effects between Taar7g and TAAR1 modulation in memory processes

    • Investigating domain-specific cognitive functions (working memory, attention, cognitive flexibility) potentially regulated by Taar7g

    • Developing targeted interventions for cognitive deficits in neuropsychiatric disorders

  • Neuroplasticity and Neuroprotection:

    • Examining Taar7g's potential role in modulating synaptic plasticity mechanisms

    • Investigating neuroprotective effects against oxidative stress and excitotoxicity

    • Analyzing potential interactions with neurotrophic signaling pathways

    • Evaluating therapeutic potential in neurodegenerative conditions

  • Innovative Imaging Applications:

    • Development of PET and SPECT radiotracers targeting Taar7g for in vivo imaging

    • Application of genetically encoded fluorescent sensors to monitor Taar7g activation in real-time

    • Implementation of new microscopy techniques to visualize Taar7g distribution at subcellular resolution

    • Creation of activity-dependent labeling strategies for Taar7g-activated neural circuits

  • Computational Neuroscience Integration:

    • Building mathematical models of Taar7g signaling networks

    • Implementing machine learning approaches to predict ligand interactions

    • Developing systems biology frameworks incorporating Taar7g into broader neurotransmitter networks

    • Creating predictive models of behavioral outcomes based on receptor modulation

These emerging directions build upon established TAAR1 research showing enhancement of novel object recognition memory and potential therapeutic applications in conditions like schizophrenia, while extending into unique domains potentially specific to Taar7g .

How do genetic variations in Taar7g affect experimental outcomes and data interpretation?

Genetic variations in Taar7g can substantially impact experimental results and require careful consideration during experimental design and data interpretation:

Methodological Framework for Addressing Genetic Variations:

Research on related receptors like TAAR1 has demonstrated that genetic background significantly impacts experimental outcomes, with TAAR1-KO mice showing specific behavioral phenotypes like impaired sensorimotor gating and perseverative behaviors . Similar careful genetic characterization is essential for valid interpretation of Taar7g studies.

What interdisciplinary approaches are advancing Taar7g research?

Advancing Taar7g research requires integration of multiple scientific disciplines, creating synergistic approaches that overcome traditional limitations:

Interdisciplinary Methodologies Advancing Taar7g Research:

  • Structural Biology and Computational Chemistry Integration:

    • Application of cryo-electron microscopy to determine Taar7g structure in various conformational states

    • Implementation of molecular dynamics simulations to predict ligand binding modes and conformational changes

    • Development of structure-based virtual screening campaigns to identify novel Taar7g ligands

    • Design of protein engineering approaches to create stabilized receptor constructs for biophysical studies

  • Systems Neuroscience and Circuit Mapping:

    • Utilization of viral tracing techniques to map neural circuits involving Taar7g-expressing neurons

    • Application of brain-wide activity mapping following Taar7g activation

    • Implementation of fiber photometry to monitor Taar7g-expressing neuron activity during behavior

    • Development of conditional genetic approaches for cell-type specific manipulation

  • Artificial Intelligence and Machine Learning Applications:

    • Training deep learning models on pharmacological datasets to predict Taar7g ligand properties

    • Implementing computer vision algorithms to automate behavioral phenotyping in Taar7g-modified animals

    • Developing natural language processing tools to synthesize literature on trace amine receptors

    • Creating predictive models for translational applications of Taar7g modulators

  • Translational Medicine Approaches:

    • Design of first-in-class selective Taar7g modulators with drug-like properties

    • Development of biomarkers to monitor Taar7g engagement in clinical studies

    • Implementation of reverse translation approaches from human genetics to animal models

    • Creation of patient-derived cellular models incorporating Taar7g genetic variants

  • Multi-omics Integration:

    • Combined application of transcriptomics, proteomics, and metabolomics to characterize Taar7g signaling networks

    • Implementation of single-cell sequencing to identify cell populations expressing Taar7g

    • Development of spatial transcriptomics approaches to map receptor expression in complex tissues

    • Application of phosphoproteomics to resolve downstream signaling pathways

These interdisciplinary approaches build on methodologies that have proven successful in related research areas, such as the characterization of TAAR1 signaling in VTA dopamine and DRN serotonin neurons using electrophysiology combined with pharmacological tools and genetic models .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.