Recombinant Rat Trace amine-associated receptor 7h (Taar7h)

Shipped with Ice Packs
In Stock

Description

Recombinant Protein Production

Recombinant TAAR7H is produced via heterologous expression systems for functional and structural studies:

SupplierExpression SystemTagPurityFormatApplicationsSource
Creative BioMartMammalian cellsN-terminal His>80%Liquid/LyophilizedBioassays, ELISA
Amerigo ScientificE. coli/YeastN/C-terminal His>90%Liquid/LyophilizedWestern Blot, ELISA

Key considerations include:

  • Optimal dilution: Mid-range concentrations recommended for ELISA accuracy .

  • Storage: Lyophilized kits stored at 4°C; recombinant proteins require -20°C or -80°C storage .

Research Applications and Findings

TAAR7H recombinant proteins are utilized in diverse studies:

Ligand-Binding Assays

  • ELISA kits (e.g., Abbexa) enable quantitative detection of TAAR7H in tissue homogenates and cell lysates, with a dynamic range of 0.156–10 ng/mL .

  • Cross-linking antibodies (e.g., Mouse Anti-polyHistidine) enhance assay sensitivity in functional studies .

Species-Specific Functions

  • Genomic divergence: Rodent TAAR7 clusters (including TAAR7H) are absent in humans, suggesting niche roles in olfaction or neurochemical regulation .

  • Therapeutic potential: While not directly studied for TAAR7H, related TAARs (e.g., TAAR1) are targets for psychostimulant and antipsychotic drugs .

Challenges and Considerations

  • Recombinant protein limitations: Native vs. recombinant TAAR7H may differ in tertiary structure, affecting ligand detection .

  • Orthologous complexity: Functional redundancy among rodent TAAR7 paralogs complicates subtype-specific research .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we currently have in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will do our best to accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please contact your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Taar7h; Ta6; Tar6; Trar6; Trace amine-associated receptor 7h; TaR-7h; Trace amine receptor 7h; Trace amine receptor 6; TaR-6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-358
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Taar7h
Target Protein Sequence
MATDDESFPWDQDSILSRDLLSALSPQLCYENLNRSCVRSPYSPGPRLILYAVFGFGAVL AVCGNLLVMTSILHFRQLHSPANFLVASLACADLLVGLTVMPFSMVRSVEGCWYFGDSYC KLHTSFDMSFCCSSLLHLCFISVDRYIAVSDPLIYPIRFTASVSGKCITFSWFLSIIYGF SLIYTGASEAGLKDLVSALSCVGGCQIPMNQSCVLINFLLFLVPTLVMMTVYSKIFLIAK QQAQNMEKMSKQTTRASDSYKDRVAKRERKAAKTLGIAVAAFLLSWLPYLIDSIIDAFLG FITPSYVYEILVWIVYYNSAMNPLIYAFFYPWFRNAIKLIVTGKILKQNSSTTNLFSE
Uniprot No.

Target Background

Function
Trace amine-associated receptor 7h (Taar7h) is an orphan receptor that may function as a receptor for trace amines. Trace amines are biogenic amines present in very low concentrations in mammalian tissues. While some trace amines have established roles as neurotransmitters in invertebrates, their function as true neurotransmitters in vertebrates remains speculative. Trace amines are likely involved in various physiological processes that are not yet fully understood.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Trace amine-associated receptor 7h (TAAR7h)?

Trace amine-associated receptor 7h (TAAR7h) is a G protein-coupled receptor (GPCR) that belongs to the trace amine-associated receptor family. It is specifically found in rats and is part of a larger superfamily of receptors that respond to trace amines, which are endogenous amine compounds present at very low concentrations in mammalian tissues. TAAR7h, like other members of the TAAR family, possesses the characteristic structural features of GPCRs including seven transmembrane domains. The receptor is encoded by a gene that is part of a cluster of TAAR genes located on chromosome 1p12 in rats . TAAR7h is involved in signal transduction pathways that are activated upon binding of trace amines and potentially other ligands, leading to cellular responses through G protein-mediated signaling cascades .

What are the structural characteristics of TAAR7h?

TAAR7h exhibits the classic structural features of G protein-coupled receptors with seven transmembrane domains. Like other members of the TAAR family, it shares specific amino acid motifs that are highly conserved. One particularly important motif is located in the seventh transmembrane domain, defined as NSXXNPXX[YH]XXX[YF]XWF, which is 100% specific to the TAAR family . This motif is crucial for receptor function and ligand binding.

The TAAR7h gene, similar to most other TAAR genes, contains a relatively short coding region of approximately 1000 base pairs derived from a single exon. This is a characteristic feature of the TAAR gene family, with TAAR2 being the only exception as it consists of two coding exons . The single-exon structure suggests a relatively simple transcriptional regulation compared to genes with multiple exons.

Additionally, TAAR7h contains several amino acid residues that are completely conserved across all members of the TAAR family, with approximately 74 residues being uniformly present across all 15 genes identified in the TAAR family. Among these, 52 residues are unique to this GPCR family and are distributed throughout the protein structure, particularly within the seven transmembrane segments . These conserved residues likely play important roles in maintaining the structural integrity of the receptor and in facilitating ligand binding and signal transduction.

How is TAAR7h related to other TAARs?

TAAR7h is one member of the larger trace amine-associated receptor family, which comprises 15 related genes with high sequence homology to each other. These receptors form a distinct subfamily within the G protein-coupled receptor superfamily. Within the TAAR family, all members share 74 completely conserved amino acid residues, of which 52 are unique to this GPCR family . These conserved residues are distributed throughout the receptor structure, with particular presence in all seven transmembrane segments.

The TAAR family in mammals shows a characteristic chromosomal organization, with all members being clustered on a single chromosome. In rats, the entire TAAR gene family is located on chromosome 1p12, while in humans they are found on chromosome 6 at band q23.1, and in mice on chromosome 10 . This conserved chromosomal clustering across species suggests a common evolutionary origin through gene duplication events.

TAAR7h belongs specifically to the TAAR7 subfamily, which may include several closely related receptor variants (potentially designated as TAAR7a, TAAR7b, etc.) depending on the species and nomenclature system. The "h" designation in TAAR7h likely indicates it is a specific variant within this subfamily. Phylogenetic analyses of the TAAR family indicate that TAAR7h shares closer sequence similarity with other TAAR7 variants than with more distantly related TAARs such as TAAR1 or TAAR2 .

What detection methods are available for studying TAAR7h?

Several detection methods are available for studying TAAR7h in research settings, each with specific applications and limitations:

  • ELISA (Enzyme-Linked Immunosorbent Assay): ELISA kits specifically designed for rat TAAR7h are available for quantitative detection of the receptor in various biological samples including tissue homogenates, cell lysates, and other biological fluids. These kits typically offer a detection range of 0.156-10 ng/ml and employ colorimetric detection methods . ELISA is particularly useful for measuring TAAR7h protein levels in experimental samples.

  • PCR-Based Detection: Degenerate oligonucleotide-primed PCR using rat genomic DNA as a template has been successfully employed to identify TAAR sequences . This approach can be adapted for specific detection of TAAR7h through the design of primers targeting unique regions of the TAAR7h gene.

  • Heterologous Expression Systems: For functional studies, TAAR7h can be cloned and expressed in heterologous cell systems such as HEK293 cells, similar to the approach used for other TAARs . This allows for pharmacological characterization of the receptor and investigation of ligand binding properties.

  • Immunohistochemistry/Immunofluorescence: These techniques use specific antibodies against TAAR7h to visualize the receptor's distribution in tissue sections or cells, providing information about its localization patterns.

  • Western Blotting: This protein detection method can be used to confirm the presence and molecular weight of TAAR7h in tissue or cell lysates using specific antibodies.

When selecting a detection method, researchers should consider factors such as the required sensitivity, specificity, and the nature of the biological question being addressed. For quantitative measurements of TAAR7h levels, ELISA offers good sensitivity and specificity, with commercially available kits having a detection range suitable for most research applications .

What is the genomic location and organization of the TAAR7h gene?

The TAAR7h gene, like all other TAAR family members in rats, is located on chromosome 1p12. This chromosomal clustering is a characteristic feature of the TAAR gene family across mammalian species, with all members being linked along a stretch of a single chromosome . In humans, the counterpart TAAR genes are located on chromosome 6 at band q23.1, while in mice they are found on chromosome 10 .

The genomic organization of TAAR7h follows the typical pattern observed for most TAAR genes, with the coding sequence being contained within a single exon. This is a distinguishing feature of the TAAR gene family, with TAAR2 being the only exception as it consists of two coding exons . The single-exon structure results in a relatively short transcript with a coding region of approximately 1000 base pairs in length.

Within the chromosomal cluster, TAAR genes have a specific orientation relative to one another, which has been preserved through evolution. This organization suggests that the entire TAAR gene family likely evolved through a series of gene duplication events from a common ancestral gene . Comprehensive genomic analyses have now established what is likely to be a complete catalog of all trace amine receptor genes across several vertebrate species, including information about their chromosomal localization and relative orientation .

How can I design experiments to investigate TAAR7h function?

Designing robust experiments to investigate TAAR7h function requires careful consideration of several key factors:

  • Define Clear Research Questions: Begin by formulating specific, testable hypotheses about TAAR7h function. For example: "Does TAAR7h activation lead to increased cAMP levels in neuronal cells?" or "Is TAAR7h expression altered in specific pathological conditions?"

  • Variable Identification: Clearly define your independent variables (e.g., different ligand concentrations, expression levels of TAAR7h) and dependent variables (e.g., receptor activation, downstream signaling events, physiological responses) . For example:

    Research QuestionIndependent VariableDependent Variable
    Effect of trace amines on TAAR7h activationConcentration of trace amine ligandscAMP levels, Ca²⁺ mobilization, or other signaling events
    TAAR7h expression in different tissuesTissue typeTAAR7h mRNA or protein levels
  • Control Design: Implement appropriate controls to validate your experimental findings:

    • Positive controls: Cells expressing well-characterized TAARs (e.g., TAAR1) with known ligands

    • Negative controls: Non-transfected cells or cells expressing unrelated receptors

    • Vehicle controls: Samples treated with the solvent used to dissolve test compounds

  • Expression Systems: Consider using heterologous expression systems such as HEK293 cells transfected with rat TAAR7h for initial characterization, similar to approaches used for other TAARs . For more physiologically relevant models, consider primary cultures from rat tissues expressing TAAR7h endogenously.

  • Functional Assays: Select appropriate assays to measure receptor activation:

    • cAMP accumulation assays (if TAAR7h couples to Gαs)

    • Calcium mobilization assays (for Gαq coupling)

    • GTPγS binding assays (direct measure of G protein activation)

    • β-arrestin recruitment assays (for investigating receptor internalization)

  • Pharmacological Characterization: Determine dose-response relationships for potential ligands, and calculate parameters such as EC₅₀ (potency) and Emax (efficacy) .

  • Molecular Approaches: Consider using techniques such as site-directed mutagenesis to identify residues critical for ligand binding or signal transduction, based on the conserved motifs identified in the TAAR family .

  • Data Analysis Plan: Design your experiment with statistical analysis in mind, ensuring adequate sample sizes and appropriate statistical tests for your hypothesis .

When conducting these experiments, remember that experimental conditions can significantly impact results. For instance, expression levels in heterologous systems may affect receptor pharmacology, and the cellular environment might influence signaling pathways. Therefore, findings should be validated across multiple experimental paradigms whenever possible.

What are the known ligands for TAAR7h?

TAARs as a family are known to respond to trace amines, which are endogenous amine compounds present at very low concentrations in mammalian tissues. These include:

  • Primary Trace Amines:

    • β-phenylethylamine (PEA)

    • p-tyramine

    • tryptamine

    • octopamine

  • Secondary Amines: Some TAARs respond to secondary amines derived from primary trace amines.

  • Thyroid Hormones: Some TAAR subtypes, particularly TAAR1, have been shown to respond to thyroid hormones like T3 (triiodothyronine).

  • Volatile Amines: Certain TAAR subtypes, especially those found in the olfactory epithelium, respond to volatile amines that may function as chemosensory cues.

For specific characterization of TAAR7h ligands, researchers would typically need to:

  • Express the receptor in a heterologous system (e.g., HEK293 cells), similar to the approach used for other TAARs .

  • Screen a library of potential ligands using functional assays that measure receptor activation, such as:

    • cAMP accumulation assays

    • Calcium mobilization assays

    • GTPγS binding assays

  • Determine structure-activity relationships by testing structural analogs of compounds that show activity.

  • Verify physiological relevance by testing whether identified ligands are present in tissues where TAAR7h is expressed.

It's important to note that different TAAR subtypes often show distinct ligand preferences, and the specific binding profile of TAAR7h may differ from that of other TAAR family members. Additionally, species differences in ligand specificity have been observed within the TAAR family, so findings from one species may not necessarily translate to another.

How do I interpret ELISA results for TAAR7h detection?

Interpreting ELISA results for TAAR7h detection requires understanding both the technical aspects of the assay and the biological context of your samples. Here's a comprehensive guide:

  • Standard Curve Analysis:

    • Generate a standard curve using the provided lyophilized TAAR7h standards within the detection range of 0.156-10 ng/ml .

    • Ensure the curve shows a good fit (R² > 0.98) with appropriate regression analysis (typically four-parameter logistic regression).

    • Use the standard curve to interpolate the concentration of TAAR7h in unknown samples.

  • Data Quality Assessment:

    • Check that absorbance values for samples fall within the linear range of the standard curve.

    • Ensure that duplicate or triplicate measurements show low variability (CV < 15%).

    • Verify that positive and negative controls give expected results.

  • Sample Concentration Calculation:

    • Convert raw absorbance values to concentration using the standard curve.

    • Account for any dilution factors applied to your original samples.

    • Express results in appropriate units (typically ng/ml or ng/g tissue).

    Sample TypeCalculation FormulaConsiderations
    Tissue homogenates[TAAR7h] = Interpolated value × Dilution factor × (Total homogenate volume / Tissue weight)Expression as ng/g tissue or normalize to total protein
    Cell lysates[TAAR7h] = Interpolated value × Dilution factor × (Lysate volume / Cell number)Can normalize to total protein content
    Biological fluids[TAAR7h] = Interpolated value × Dilution factorReport as absolute concentration
  • Data Normalization:

    • For tissue homogenates and cell lysates, normalize TAAR7h levels to total protein content (measured by Bradford or BCA assay) to account for variations in sample preparation.

    • For comparative studies, consider using appropriate housekeeping proteins or reference genes as internal controls.

  • Interpreting Biological Significance:

    • Compare TAAR7h levels across different experimental conditions or groups.

    • Consider the biological context - is TAAR7h expression expected to increase, decrease, or remain unchanged in your experimental paradigm?

    • Correlate TAAR7h levels with other functional readouts or physiological parameters when possible.

  • Potential Limitations:

    • Be aware that the assay measures total TAAR7h protein and does not distinguish between functional (properly folded, membrane-inserted) and non-functional receptor.

    • Consider potential cross-reactivity with other TAAR family members, especially when working with complex samples.

    • Remember that the kit is for research use only, not for diagnostic or therapeutic procedures .

  • Statistical Analysis:

    • Apply appropriate statistical tests based on your experimental design.

    • Consider power analysis to ensure adequate sample size for detecting biologically relevant differences.

By carefully following these guidelines, you can generate reliable and meaningful data on TAAR7h levels in your experimental system, contributing to a better understanding of this receptor's expression patterns and potential functions.

What are the common challenges in TAAR7h research?

  • Receptor Expression Challenges:

    • Low endogenous expression levels in native tissues can make detection difficult

    • Heterologous expression systems may not recapitulate the natural cellular environment

    • Surface trafficking issues can lead to intracellular retention of recombinant receptors

  • Pharmacological Limitations:

    • Incomplete characterization of specific ligands for TAAR7h

    • Potential overlapping pharmacology with other TAAR subtypes

    • Lack of highly selective agonists and antagonists for TAAR7h

  • Technical Detection Issues:

    • Limited availability of highly specific antibodies for TAAR7h

    • Cross-reactivity concerns with other TAAR family members

    • Sensitivity limitations with current detection methods, especially for low abundance receptors

  • Experimental Design Complexities:

    • Difficulty controlling for extraneous variables in complex biological systems

    • Challenges in designing appropriate control experiments

    • Sample size and statistical power considerations for detecting potentially subtle effects

  • Species Differences:

    • Species-specific differences in TAAR expression and function

    • TAAR7h is specific to rats, limiting translational relevance to human biology

    • Variations in genomic organization and receptor properties across species

  • Functional Characterization Challenges:

    • Limited understanding of the signaling pathways coupled to TAAR7h

    • Difficulty distinguishing primary from secondary effects of receptor activation

    • Potential for constitutive activity affecting baseline measurements

  • Resource Limitations:

    • Restricted availability of specialized tools for TAAR7h research

    • Commercial reagents like ELISA kits have specific limitations in detection range (0.156-10 ng/ml)

    • Need for custom development of research tools

  • Data Interpretation Complexities:

    • Phenotypic effects may be influenced by genetic background

    • Potential compensatory mechanisms in genetic models

    • Challenges in distinguishing receptor function in complex neural circuits

Addressing these challenges requires multidisciplinary approaches, including:

  • Development of more specific molecular tools for TAAR7h

  • Improved heterologous expression systems that better mimic native environments

  • Advanced imaging techniques to study receptor localization and trafficking

  • Computational approaches to predict structure-function relationships

  • Careful experimental design with appropriate controls and sample sizes

By recognizing and systematically addressing these challenges, researchers can make meaningful progress in elucidating the biological roles of TAAR7h and its potential relevance to physiological and pathological processes.

How can I optimize recombinant expression of TAAR7h for functional studies?

Optimizing recombinant expression of TAAR7h for functional studies requires careful consideration of multiple factors to ensure proper receptor folding, trafficking, and functionality. Here's a comprehensive approach:

  • Expression System Selection:

    • Mammalian Cell Lines: HEK293 cells have been successfully used for other TAARs and represent a good starting point for TAAR7h. Other options include CHO-K1 or COS-7 cells.

    • Insect Cell Systems: Sf9 or Hi5 cells may provide higher expression levels for difficult-to-express GPCRs.

    • Cell-Free Systems: Consider for initial binding studies, though less suitable for functional assays.

  • Vector Design Considerations:

    • Promoter Selection: Strong constitutive promoters (CMV, EF1α) for high expression; inducible promoters (TET-on) to control expression timing.

    • Fusion Tags: Consider N-terminal tags (FLAG, HA) for detection and purification, but position carefully to avoid interference with signal peptide processing.

    • Codon Optimization: Adjust codon usage for the host expression system to enhance translation efficiency.

  • N-Terminal Modifications:

    • Signal Sequence Optimization: Native signal sequences may be suboptimal; consider replacing with efficient trafficking signals (e.g., from rhodopsin).

    • N-Glycosylation Sites: Preserve natural N-glycosylation sites, which are often crucial for proper folding and trafficking.

  • Improving Surface Expression:

    • Chaperone Co-expression: Co-transfect with chaperone proteins (e.g., calnexin, BiP) to assist in proper folding.

    • Temperature Modulation: Lower incubation temperature (30-32°C instead of 37°C) may improve folding of difficult receptors.

    • Chemical Chaperones: Addition of dimethyl sulfoxide (0.5-2%), glycerol (5-10%), or trimethylamine N-oxide (50-100 mM) to culture medium.

  • Transfection Optimization:

    ParameterOptimization StrategyConsiderations
    DNA:Transfection Reagent RatioTest multiple ratios (e.g., 1:2, 1:3, 1:4)Optimal ratio varies by cell type and reagent
    Cell Density70-90% confluency at transfectionToo low or high density reduces efficiency
    Duration24-72h post-transfectionExpression peaks at different times for different constructs
    Medium ConditionsSerum-free during transfection; complete medium afterFollow reagent manufacturer guidelines
  • Stable Cell Line Development:

    • Consider generating stable cell lines for consistent expression levels.

    • Use antibiotic selection markers (G418, puromycin) for selection.

    • Screen multiple clones to identify high expressors.

    • Confirm genomic integration and long-term stability.

  • Functional Validation:

    • Receptor Localization: Confirm membrane localization using confocal microscopy or surface biotinylation.

    • Ligand Binding: Verify ligand binding capabilities using radioligand binding or fluorescent ligands.

    • Signaling Assays: Test receptor functionality using cAMP, calcium, or other second messenger assays.

    • Control Experiments: Include wild-type receptor and non-transfected cells as controls.

  • Troubleshooting Strategies:

    • If expression is low, check mRNA levels to distinguish between transcription and translation/trafficking issues.

    • For intracellular retention, try trafficking enhancers or identify retention motifs that could be modified.

    • If receptor is unstable, consider adding stabilizing mutations identified in other GPCRs.

By systematically optimizing these parameters, you can develop a robust expression system for TAAR7h that allows for reliable functional characterization and pharmacological profiling.

How do genetic variants in TAAR7h affect receptor function?

Genetic variants in TAAR7h can significantly impact receptor function through multiple mechanisms affecting different aspects of receptor biology. While specific data on TAAR7h variants is limited in the provided search results, we can analyze potential effects based on general principles of GPCR biology and what is known about the TAAR family:

  • Ligand Binding Domain Variants:

    • Mutations in the conserved TAAR family motif NSXXNPXX[YH]XXX[YF]XWF in the seventh transmembrane domain are likely to significantly affect ligand recognition and binding affinity .

    • Variants in the 52 amino acid residues that are unique to the TAAR family and scattered throughout the transmembrane segments may alter ligand specificity or binding pocket architecture .

  • G-Protein Coupling Region Variants:

    • Mutations in intracellular loops, particularly the third intracellular loop (ICL3), may alter coupling efficiency to specific G-protein subtypes.

    • Changes in the DRY motif (common in GPCRs) or equivalent regions in TAAR7h could affect G-protein activation.

  • Receptor Expression and Trafficking Effects:

    • Variants in the N-terminal region may affect signal peptide processing and receptor trafficking to the cell surface.

    • Mutations affecting potential glycosylation sites could impair proper folding and cell surface expression.

  • Functional Impact Categories:

    Variant TypePotential Functional ConsequencesDetection Methods
    Loss-of-functionReduced/abolished ligand binding or signalingFunctional assays comparing wild-type vs. variant
    Gain-of-functionEnhanced signaling or constitutive activityBaseline activity measurements in absence of ligand
    Altered specificityChanged ligand preference profileComparative pharmacological profiling
    Regulatory variantsAltered expression levels or patternsqPCR, Western blot, reporter assays
  • Single Nucleotide Polymorphisms (SNPs):

    • While specific TAAR7h SNPs have not been detailed in the search results, genome-wide association studies (GWAS) have identified SNPs in other TAAR genes associated with various phenotypes, including migraine, respiratory function, and sensory perception .

    • Similar approaches could identify functional variants in TAAR7h associated with specific phenotypes in rats.

  • Experimental Approaches to Characterize Variants:

    • Site-directed mutagenesis to introduce specific variants into wild-type TAAR7h

    • Heterologous expression systems to compare wild-type and variant receptor function

    • Structure-function analyses based on homology modeling with other GPCRs

    • In vivo studies in model organisms with engineered variants

  • Computational Prediction Methods:

    • Sequence conservation analysis across species to identify functionally critical residues

    • Molecular dynamics simulations to predict structural consequences of variants

    • Machine learning approaches to integrate sequence, structural, and functional data

Understanding the impact of TAAR7h genetic variants is essential not only for basic receptor characterization but also for potential implications in individual differences in physiological responses and potentially in disease susceptibility. Systematic characterization of naturally occurring and experimentally induced variants can provide valuable insights into structure-function relationships of this receptor.

How can I design knockout or knockdown experiments for TAAR7h?

Designing effective knockout or knockdown experiments for TAAR7h requires careful consideration of the experimental approach, controls, and validation strategies. Here's a comprehensive guide:

  • Gene Knockout Strategies:

    a) CRISPR-Cas9 System:

    • Design 2-3 guide RNAs (gRNAs) targeting early exons of the TAAR7h gene

    • Target the single exon that contains the entire coding sequence, characteristic of most TAAR genes

    • Include PAM sequences compatible with your Cas9 variant

    • Verify target specificity to avoid off-target effects on other TAAR family members located in the same chromosomal region (rat chromosome 1p12)

    b) Homologous Recombination:

    • Design targeting vectors with homology arms flanking the TAAR7h coding region

    • Include a selection marker (e.g., neomycin resistance) for positive selection

    • Consider adding a reporter gene (e.g., GFP) to track successful targeting

  • Gene Knockdown Approaches:

    a) RNA Interference (RNAi):

    • Design 3-4 siRNA or shRNA sequences targeting different regions of TAAR7h mRNA

    • Avoid sequences with homology to other TAAR family members

    • Test efficacy of each siRNA/shRNA individually and select the most effective

    b) Antisense Oligonucleotides (ASOs):

    • Design ASOs targeting TAAR7h mRNA, typically 15-25 nucleotides in length

    • Incorporate chemical modifications (e.g., phosphorothioate backbones) to enhance stability

    • Test multiple designs to identify optimal knockdown efficiency

  • Experimental Design Considerations:

    ParameterKnockout ExperimentsKnockdown Experiments
    Duration of EffectPermanentTemporary (days to weeks)
    Cell/Animal ModelsCell lines, primary cells, whole animalsCell lines, primary cells, tissue-specific in vivo
    Controls RequiredWild-type cells/animals, heterozygous animalsScrambled siRNA/shRNA, non-targeting ASOs
    Delivery MethodsTransfection, viral vectors, embryonic manipulationTransfection, electroporation, viral vectors, direct injection
    Timing ConsiderationsAllow for clonal selection and expansionMonitor time course of knockdown effects
  • Validation Strategies:

    a) Genomic Validation (for knockouts):

    • PCR amplification and sequencing of the targeted region

    • Southern blot analysis to confirm correct targeting

    • Whole genome sequencing to assess off-target mutations

    b) Expression Validation:

    • RT-qPCR to measure TAAR7h mRNA levels

    • Western blot or ELISA to confirm protein reduction/absence

    • Immunocytochemistry/immunohistochemistry to assess cellular expression patterns

    c) Functional Validation:

    • Ligand binding assays to confirm loss of binding capacity

    • Signaling assays (cAMP, Ca²⁺) to verify abrogated downstream responses

    • Phenotypic assays relevant to suspected TAAR7h functions

  • Experimental Controls:

    • Include wild-type (non-manipulated) cells/animals as positive controls

    • Use heterozygous animals to study gene dosage effects

    • Consider rescue experiments by re-expressing TAAR7h to confirm specificity

    • Include closely related receptor knockouts/knockdowns to assess selectivity

  • Potential Challenges and Solutions:

    • Compensatory mechanisms: Monitor expression of other TAAR family members

    • Developmental effects: Consider inducible knockout systems for temporal control

    • Off-target effects: Validate with multiple knockout/knockdown strategies

    • Incomplete knockdown: Optimize delivery methods or use combinatorial approaches

By carefully designing your knockout or knockdown strategy with appropriate controls and validation methods, you can generate valuable tools for investigating TAAR7h function in various experimental contexts . Remember that different approaches have complementary strengths and limitations, so combining multiple strategies can provide more robust insights into TAAR7h biology.

What computational methods can be used to predict TAAR7h-ligand interactions?

Computational methods offer powerful approaches to predict and analyze TAAR7h-ligand interactions before conducting resource-intensive experimental studies. Here's a comprehensive overview of applicable computational methods:

  • Homology Modeling and Structure Prediction:

    • Generate a 3D structural model of TAAR7h based on crystal structures of related GPCRs

    • Incorporate the characteristic TAAR family motif (NSXXNPXX[YH]XXX[YF]XWF) from the seventh transmembrane domain as a constraint

    • Validate the model through energy minimization and structural quality assessment

    • Refine models using molecular dynamics simulations to explore conformational flexibility

  • Binding Site Identification:

    • Analyze the conserved residues unique to the TAAR family to identify potential ligand-binding pockets

    • Use cavity detection algorithms (e.g., POCKET, LIGSITE, SiteMap) to identify potential binding sites

    • Compare with known binding sites of other characterized TAARs

    • Perform evolutionary trace analysis to identify functionally important residues

  • Molecular Docking Approaches:

    Docking MethodAdvantagesLimitationsSuitable Software
    Rigid receptor dockingComputationally efficientIgnores receptor flexibilityAutoDock, DOCK
    Flexible dockingAccounts for side-chain movementsComputationally intensiveGOLD, Glide, FlexX
    Ensemble dockingCaptures multiple receptor conformationsRequires multiple starting structuresAutoDock Vina, Rosetta
    Induced-fit dockingModels mutual adaptation of ligand and receptorVery computationally expensiveSchrödinger IFD, HADDOCK
  • Virtual Screening Workflows:

    • Prepare a library of potential TAAR7h ligands based on known trace amines and structural analogs

    • Perform hierarchical screening:

      • Initial phase: Fast docking or pharmacophore-based filtering

      • Secondary phase: More rigorous docking of promising candidates

      • Final phase: Detailed binding energy calculations

    • Rank compounds based on predicted binding affinity and interaction profiles

  • Molecular Dynamics Simulations:

    • Perform all-atom MD simulations of TAAR7h-ligand complexes in explicit membrane environments

    • Analyze binding stability, residence time, and conformational changes upon ligand binding

    • Calculate binding free energies using methods like MM-GBSA or FEP

    • Identify key interaction networks and water-mediated contacts

  • Machine Learning Approaches:

    • Develop QSAR (Quantitative Structure-Activity Relationship) models for TAAR ligands

    • Use deep learning techniques to predict binding affinities from structural features

    • Implement graph neural networks to capture atomic interaction patterns

    • Integrate experimental data with computational predictions for model refinement

  • Analysis of Results and Experimental Validation:

    • Generate testable hypotheses about key binding residues

    • Design site-directed mutagenesis experiments to verify computational predictions

    • Prioritize compounds for experimental testing based on computational rankings

    • Iteratively refine computational models based on experimental feedback

  • Special Considerations for TAAR7h:

    • Account for the unique structural features of the TAAR family, including the conserved motifs

    • Consider potential allosteric binding sites in addition to orthosteric sites

    • Evaluate the impact of membrane environment on ligand access and binding

    • Compare predictions with experimentally characterized TAAR subtypes

These computational approaches not only help in identifying potential ligands for TAAR7h but also provide mechanistic insights into ligand recognition and binding that can guide experimental design and interpretation. The integration of multiple computational methods with strategic experimental validation represents the most powerful approach for elucidating TAAR7h-ligand interactions.

How does TAAR7h signaling integrate with other neurotransmitter systems?

TAAR7h signaling likely interfaces with other neurotransmitter systems through multiple molecular and cellular mechanisms, creating complex regulatory networks. While specific data on TAAR7h integration is limited in the provided search results, we can analyze potential interaction mechanisms based on what is known about the TAAR family and GPCR signaling integration:

  • Receptor-Level Interactions:

    • Heteromerization: TAAR7h may form heteromeric complexes with other GPCRs, altering signaling properties of both receptors

    • Cross-desensitization: Activation of TAAR7h could lead to phosphorylation and desensitization of other GPCRs through shared kinase pathways

    • Shared G-protein pools: Competition for limited G-protein resources in the same cellular compartments

  • Signaling Pathway Crosstalk:

    • Second messenger convergence: TAAR7h likely couples to G-proteins that modulate cAMP or Ca²⁺ levels, affecting signaling cascades shared with other neurotransmitter systems

    • Protein kinase activation: Downstream kinases activated by TAAR7h signaling (e.g., PKA, PKC) may phosphorylate components of other signaling pathways

    • Scaffold protein interactions: Signaling complexes organized by scaffold proteins might integrate TAAR7h signals with other neurotransmitter pathways

  • Cellular Integration Mechanisms:

    Integration LevelMechanismFunctional Consequence
    PresynapticModulation of neurotransmitter releaseAltered neurotransmitter availability
    PostsynapticCo-regulation of neuronal excitabilityModified response to neurotransmitters
    Circuit-levelAltered excitation/inhibition balanceNetwork activity changes
    NeuromodulatoryLong-term changes in synaptic strengthPlasticity and learning effects
  • Specific Neurotransmitter System Interactions:

    • Monoaminergic systems: As trace amine receptors, TAARs likely interact with canonical monoamine systems (dopamine, serotonin, norepinephrine)

    • Glutamatergic transmission: Potential modulation of ionotropic and metabotropic glutamate receptor function

    • GABAergic inhibition: Possible regulation of inhibitory tone through GABA receptor modulation

    • Neuropeptide systems: Integration with neuropeptide signaling in shared neural circuits

  • Temporal Dimensions of Integration:

    • Acute interactions: Immediate signaling crosstalk occurring within seconds to minutes

    • Intermediate adaptations: Receptor trafficking and expression changes (minutes to hours)

    • Long-term adaptations: Transcriptional and epigenetic modifications affecting multiple systems (hours to days)

  • Experimental Approaches to Study Integration:

    • Electrophysiology: Record changes in neuronal activity and synaptic transmission

    • Multiplexed signaling assays: Simultaneously measure multiple second messengers

    • Optogenetic or chemogenetic approaches: Selectively activate TAAR7h in specific circuits

    • Multi-omics approaches: Integrate transcriptomic, proteomic, and metabolomic data

    • Computational modeling: Simulate complex signaling networks and predict system behaviors

  • Regional Specificity of Integration:

    • Integration mechanisms may differ based on brain region and cell type

    • Co-expression patterns of TAAR7h with other receptors likely determine interaction possibilities

    • Circuit-specific effects may emerge from regional differences in signaling machinery

Understanding these integration mechanisms is crucial for elucidating the physiological role of TAAR7h in complex neural processes. Future research should focus on identifying the specific neurotransmitter systems that interact with TAAR7h signaling, the molecular mechanisms underlying these interactions, and their functional consequences at cellular and network levels.

What are the translational implications of TAAR7h research for human health?

Understanding the translational implications of TAAR7h research requires careful consideration of both its species-specific nature and potential relevance to human health through comparative biology approaches. While TAAR7h itself is specific to rats, insights from its study may inform broader understanding of the TAAR family with potential human health applications:

  • Species Differences and Homology Considerations:

    • TAAR7h is a rat-specific receptor without a direct human ortholog, as the TAAR gene family has undergone significant evolutionary divergence across species

    • Humans possess 6 functional TAAR genes, while rats have a more expanded repertoire including TAAR7h

    • Comparative studies of TAAR7h may provide insights into the functional evolution of the entire TAAR family

  • Potential Relevance to Neuropsychiatric Disorders:

    • TAARs have been implicated in various neuropsychiatric conditions through GWAS studies, including:

      • Migraine associations with TAAR6 and TAAR7P (pseudogene)

      • Potential links to schizophrenia and bipolar disorder for some TAAR family members

    • While TAAR7h-specific insights cannot be directly translated, mechanistic understandings may inform research on human TAARs in these conditions

  • Respiratory System Applications:

    • GWAS studies have identified TAAR6 variants associated with response to inhaled corticosteroids and changes in forced expiratory volume

    • TAAR2 variants have been linked to β-blocker response

    • Comparative pharmacology between rat TAAR7h and human TAARs could inform respiratory drug development

  • Developmental Neurobiology Insights:

    • TAAR6 and TAAR8 have been associated with cerebellar growth

    • Understanding signaling mechanisms of TAAR7h in rat neurodevelopment may provide conceptual frameworks for studying human TAAR roles in brain development

  • Translational Research Considerations:

    Research AreaTAAR7h ContributionHuman Translation Pathway
    PharmacologyIdentification of novel ligand structuresDesign of selective compounds for human TAARs
    Signal TransductionElucidation of signaling mechanismsComparative analysis with human TAAR signaling
    Physiological FunctionUnderstanding of role in rat physiologyHypothesis generation for human TAAR functions
    Genetic VariationEffects of TAAR7h variants on functionConceptual models for human TAAR variant effects
  • Drug Discovery Implications:

    • Novel ligands identified for TAAR7h could serve as starting points for developing compounds targeting human TAARs

    • Understanding TAAR7h structure-function relationships may guide rational drug design for human TAARs

    • TAAR7h research models could serve as preliminary screening systems before advancing to human TAAR studies

  • Methodological Advances:

    • Technical approaches developed for TAAR7h research, such as specialized ELISA detection methods , may be adaptable for human TAAR studies

    • Experimental design principles for investigating TAAR7h can inform human TAAR research strategies

  • Future Research Directions with Translational Potential:

    • Comparative studies between rat TAAR7h and human TAARs

    • Development of humanized models incorporating human TAARs in rat systems

    • Integration of TAAR7h findings with human genetic and functional data

    • Computational approaches to extend rat TAAR7h insights to human TAAR biology

While direct translation of TAAR7h-specific findings to human health requires caution due to species differences, the broader principles uncovered through rigorous TAAR7h research can significantly advance our understanding of the entire TAAR family and potentially inform new therapeutic approaches for conditions involving trace amine signaling in humans.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.