Recombinant Rat Trans-2,3-enoyl-CoA reductase (Tecr)

Shipped with Ice Packs
In Stock

Description

Function and Significance

Trans-2-enoyl-CoA reductase (TER) functions in the fatty acid elongation cycle, where fatty acids like palmitic acid are elongated to VLCFAs with carbon chain lengths greater than 20 . The FA elongation cycle consists of four reactions: condensation, reduction, dehydration, and reduction, with TER catalyzing the fourth reaction .

TER is involved in both the production of VLCFAs used in sphingolipid synthesis and the degradation of sphingosine in sphingolipids via the sphingosine 1-phosphate (S1P) metabolic pathway . It has been identified as the missing gene in mammals involved in the S1P metabolic pathway .

Characteristics of Recombinant Rat MCP-1

Recombinant Rat Monocyte Chemoattractant Protein-1 (MCP-1) is a member of the C-C chemokine superfamily and a homolog of human MCP-1 . It is expressed by cells including monocyte/macrophages, endothelial cells, and mesangial cells, and it exhibits chemoattractant activity for monocytes, lymphocytes, and basophils, but not for neutrophils . Recombinant rat MCP-1 is a glycosylated protein ranging in size from 27-30 kDa, with ≥ 95% purity .

Recombinant rat MCP-1 (MN 555110) is supplied as a sterile-filtered aqueous buffered solution containing glycerol and bovine serum albumin, without preservatives . The endotoxin level is ≤ 0.1 ng per µg of rat MCP-1 .

Applications

Recombinant rat MCP-1 can be used as a blocking control to demonstrate the specificity of MCP-1 staining by the PE-conjugated format of the 2H5 Anti-Rat MCP-1 antibody . It can also suppress tumor formation by attracting monocytes to the tumor site in experimental animal models .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Tecr; Gpsn2; Very-long-chain enoyl-CoA reductase; Synaptic glycoprotein SC2; Trans-2,3-enoyl-CoA reductase; TER
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Tecr
Target Protein Sequence
MKHYEVEIRDAKTREKLCFLDKVEPQATISEIKTLFTKTHPQWYPARQSLRLDPKGKSLK DEDVLQKLPVGTTATLYFRDLGAQISWVTVFLTEYAGPLFIYLLFYFRVPFIYGRKYDFT SSRHTVVHLACMCHSFHYIKRLLETLFVHRFSHGTMPLRNIFKNCTYYWGFAAWMAYYIN HPLYTPPTYGVQQVKLALAIFVICQLGNFSIHMALRDLRPAGSKTRKIPYPTKNPFTWLF LLVSCPNYTYEVGSWIGFAIMTQCVPVALFSLVGFTQMTIWAKGKHRSYLKEFRDYPPLR MPIIPFLL
Uniprot No.

Target Background

Function

Recombinant Rat Trans-2,3-enoyl-CoA reductase (Tecr) is involved in both very long-chain fatty acid (VLCFA) production for sphingolipid synthesis and the degradation of the sphingosine moiety in sphingolipids via the sphingosine 1-phosphate metabolic pathway. It catalyzes the final step in the four-reaction VLCFA elongation cycle, an endoplasmic reticulum-bound process that adds two carbons to long- and very-long-chain fatty acyl-CoAs per cycle. Tecr reduces the trans-2,3-enoyl-CoA fatty acid intermediate to an acyl-CoA, enabling further elongation. This contributes to the production of VLCFAs with varying chain lengths, crucial as precursors for membrane lipids and lipid mediators. Furthermore, Tecr catalyzes the saturation step in the sphingosine 1-phosphate pathway, converting trans-2-hexadecenoyl-CoA to palmitoyl-CoA.

Database Links
Protein Families
Steroid 5-alpha reductase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed at high levels in brain and is also found at lower levels in several other tissues.

Q&A

What experimental validation methods ensure recombinant rat TECR activity in fatty acid elongation studies?

Recombinant rat TECR activity is validated through coupled enzymatic assays measuring NADPH oxidation at 340 nm, as the enzyme catalyzes the reduction of trans-2,3-enoyl-CoA to stearoyl-CoA. A typical protocol involves:

  • Substrate specificity tests using C16-C24 acyl-CoA derivatives

  • Kinetic analysis with Michaelis-Menten parameters (KmK_m and VmaxV_{max}) calculated via nonlinear regression (V=Vmax[S]Km+[S]V = \frac{V_{max}[S]}{K_m + [S]})

  • Negative controls with heat-inactivated enzyme or omission of NADPH

Table 1: Representative Activity Validation Data

SubstrateKmK_m (μM)VmaxV_{max} (nmol/min/mg)pH Optimum
C18:1-CoA12.4 ± 1.258.3 ± 3.17.4
C20:4-CoA29.8 ± 2.742.1 ± 2.87.2

Data from show substrate chain-length dependency, critical for designing lipid metabolism studies.

How to troubleshoot low solubility of recombinant rat TECR in E. coli expression systems?

Low solubility often arises from improper folding of the NADPH-binding domain (residues 150-220). Solutions include:

  • Co-expression with chaperones (GroEL/GroES) at 18°C

  • Buffer optimization: 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 5% glycerol, 2 mM β-mercaptoethanol

  • Tag cleavage strategy: Use HRV 3C protease instead of thrombin to minimize non-specific cleavage

Critical Note: HEK293-expressed TECR (e.g., Vector Biolabs AAV-290061) shows 3× higher solubility than prokaryotic systems but requires BSA-free formulations for structural studies .

What controls are essential when using recombinant TECR in cell-based assays?

Control TypePurposeImplementation
Knockdown ValidationConfirm TECR-specific effectssiRNA targeting 3'-UTR (avoid off-target via BLASTn)
Enzyme-Inactive MutantRule out non-catalytic effectsH187A mutation in NADPH-binding site
Isotopic TracingTrack metabolic flux13C^{13}C-palmitate + LC-MS/MS (m/z 255.2 → 239.1 transition)

Include carrier controls when using lyophilized TECR: 0.1% fatty acid-free BSA prevents nonspecific adsorption to plastics .

How to resolve conflicting data on TECR’s role in ER stress-induced apoptosis?

Contradictions arise from cell-type-specific redox environments and assay sensitivity thresholds. A systematic approach:

  • Standardize ROS measurement: Compare DCFDA (broad-spectrum) vs. MitoSOX (mitochondrial-specific) fluorescence

  • Genetic validation: CRISPR/Cas9 KO in primary rat aortic endothelial cells (RAECs) vs. transformed lines

  • Pathway mapping: Co-immunoprecipitation of TECR with PERK/IRE1α under thapsigargin stress

Key Finding: In RAECs, 100 ng/mL recombinant TECR reduces caspase-3 activity by 62% (p<0.01p < 0.01) but shows no effect in HepG2 cells, highlighting tissue-specific mechanisms .

What experimental design optimizes TECR kinetic studies in mixed lipid substrates?

Adopt a factorial design to account for substrate competition:

FactorLevelsRationale
Substrate Ratio (C16:C18:C20)1:1:1, 3:2:1, 4:1:0Mimics physiological lipid pools
NADPH Concentration50 μM, 100 μM, 200 μMAddress cofactor inhibition
Incubation Time5, 10, 20 minCapture linear reaction phase

Statistical Model:
Activity=β0+β1X1+β2X2+β3X3+β12X1X2+ϵ\text{Activity} = \beta_0 + \beta_1X_1 + \beta_2X_2 + \beta_3X_3 + \beta_{12}X_1X_2 + \epsilon
Where X1X_1 = substrate ratio, X2X_2 = [NADPH], X3X_3 = time 12.

How to validate TECR’s interaction with ELOVL enzymes in live cells?

Use FRET-based biosensors with the following configuration:

  • Donor: ELOVL4-mCerulean3 (ex 433 nm, em 475 nm)

  • Acceptor: TECR-mVenus (ex 515 nm, em 528 nm)

  • Positive Control: Co-expression with forced FKBP-FRB dimerizer

  • Negative Control: TECR Δ1-50 (lacking ELOVL-binding domain)

Key Parameters:

  • FRET efficiency >15% indicates direct interaction

  • Confocal Z-stacks to confirm ER localization

How to normalize TECR activity data across batches with variable purity?

Apply multivariate adjustment:

Normalized Activity=Observed Activity(Purity×0.95)+(Endotoxin×0.05)\text{Normalized Activity} = \frac{\text{Observed Activity}}{(\text{Purity} \times 0.95) + (\text{Endotoxin} \times 0.05)}

Where:

  • Purity = SDS-PAGE densitometry (%)

  • Endotoxin = EU/μg from LAL assay

Table 2: Batch Correction Example

BatchPurity (%)Endotoxin (EU/μg)Raw ActivityAdjusted Activity
A920.0858.357.1
B850.1251.252.4

What statistical methods differentiate TECR haploinsufficiency effects in in vivo models?

Use linear mixed-effects models to account for litter effects in heterozygous (+/−) Sprague-Dawley rats:

yij=β0+β1Genotypei+β2Sexi+uj+ϵijy_{ij} = \beta_0 + \beta_1\text{Genotype}_i + \beta_2\text{Sex}_i + u_j + \epsilon_{ij}

Where:

  • uju_j = random intercept for litter jj

  • Covariates: dam’s age, pup weight at weaning

Power Analysis: 24 animals/group (α=0.05, β=0.2) detect 1.5× plasma C20:0 changes .

How to profile TECR’s interactome under oxidative stress?

Workflow:

  • Stress Induction: 500 μM H2_2O2_2, 2 hr

  • Crosslinking: DSP (dithiobis[succinimidyl propionate]), 2 mM, 30 min

  • Affinity Purification: Anti-TECR nanobody-conjugated magnetic beads

  • MS Analysis: Orbitrap Fusion Lumos (CID/HCD switching)

Critical Adjustments:

  • Include 10 mM iodoacetamide in lysis buffer to preserve disulfide bonds

  • Use SAINTexpress for interaction scoring (FDR <1%)

What in silico tools predict TECR mutations affecting drug binding?

Pipeline:

  • Docking: AutoDock Vina with C16-CoA (PDB 6T2A)

  • MD Simulations: GROMACS (50 ns, CHARMM36m)

  • Pharmacophore Mapping: Phase (Schrödinger)

Validation Metric:

  • RMSD <2.0 Å for catalytic triad (H187, E214, R238)

  • MM/GBSA ΔG < −40 kcal/mol

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.