Recombinant Rat Translocase of inner mitochondrial membrane domain-containing protein 1 (Timmdc1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rat TIMMDC1

Recombinant Rat TIMMDC1 (Translocase of Inner Mitochondrial Membrane Domain-Containing Protein 1) is a multi-pass membrane protein critical for mitochondrial Complex I assembly. It plays a central role in the biogenesis of the mitochondrial electron transport chain (ETC), particularly in constructing the membrane arm of Complex I (NADH:ubiquinone oxidoreductase) . The recombinant form is engineered for research applications, often expressed with purification tags (e.g., His-tag) to facilitate isolation and study .

Molecular Properties

ParameterDetail
Molecular Weight~32.2 kDa (predicted)
Transmembrane Domains4-pass structure with N-terminal/C-terminal extensions in mitochondrial matrix
Protein Length285 amino acids (Rat)
LocalizationInner mitochondrial membrane
Role in ETCChaperone for Complex I assembly; stabilizes core subunits

Key Functions

  • Complex I Assembly: Facilitates integration of mitochondrial DNA-encoded subunits (e.g., ND1) into the membrane arm of Complex I .

  • Metabolic Regulation: Influences mitochondrial respiration, ATP synthesis, and reactive oxygen species (ROS) production .

  • Disease Association: Mutations in TIMMDC1 (e.g., deep intronic variant c.597-1340A>G) cause severe neurologic dysfunction and mitochondrial disorders .

Experimental Uses

  1. Mitochondrial Function Studies:

    • Complex I Activity Assays: Knockdown of TIMMDC1 reduces ATP-linked respiration and complex I activity .

    • Proteomics: SILAC-based quantitative proteomics to study subcomplex assembly defects .

  2. Cancer Research:

    • Gastric Cancer Models: TIMMDC1 depletion inhibits growth, migration, and glycolysis via AKT/GSK3β/β-catenin pathway modulation .

    • Lung Cancer: Overexpression correlates with metastasis, while depletion suppresses cell migration .

  3. Therapeutic Development:

    • Splice-Switching Antisense Oligonucleotides (SSOs): Correct aberrant splicing caused by intronic TIMMDC1 mutations (e.g., c.597-1340A>G) to restore protein levels and Complex I function .

Protein Interactions

Interacting ProteinRole in Complex I AssemblySource
MCIA ComplexForms assembly intermediate with TIMMDC1
FATE1Associates with TIMMDC1 in the inner mitochondrial membrane
NDUFAF1/ACAD9Co-assembles with TIMMDC1 during membrane arm construction

Involved Pathways

Pathway NameKey Proteins/FunctionsSource
Respiratory Electron TransportND1, ETFA, ETFB, SURF1, COX18
TCA Cycle and Heat ProductionSLC25A27, UCP2, PDPR, ADHFE1
MetabolismISCU, OXSR1, CSNK1G2, CKMB

Genetic Mutations

  • Pathogenic Variant: TIMMDC1 c.597-1340A>G (deep intronic) causes aberrant splicing, leading to:

    • Neurodevelopmental Defects: Failure to thrive, hypotonia, drug-resistant epilepsy .

    • Mitochondrial Dysfunction: Loss of Complex I activity and ATP production .

Therapeutic Interventions

  • SSO-Mediated Correction: Restores TIMMDC1 mRNA and protein levels, rescuing Complex I function in patient fibroblasts .

  • Preclinical Models: Knockdown in gastric cancer cells reduces tumor growth and metastasis in vivo .

Amino Acid Sequence and Biochemical Features

The Rat TIMMDC1 sequence (UniProt: Q6AY94) spans 285 residues with a predicted topology of four transmembrane helices . Key regions include:

RegionAmino AcidsFunctionSource
N-Terminal1–50Mitochondrial matrix-facing
Transmembrane51–200Membrane-embedded core
C-Terminal201–285Matrix-facing regulatory domain

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs. For dry ice shipping, please contact us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. We suggest storing working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To facilitate long-term storage at -20°C/-80°C, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life can be influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
Timmdc1; Complex I assembly factor TIMMDC1, mitochondrial; Translocase of inner mitochondrial membrane domain-containing protein 1; TIMM domain containing-protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-285
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Timmdc1
Target Protein Sequence
MEAPPPAPRSRLCGAWGPFPRVFAAGAVAADSQSFVEDPELRSYVSDPGSSESGWDRLRQ LFVKDEQRKISKEMDYICRAALSAGIIGWAYGGIPAFIYAKRRYIEQSQAEIYHNRFDAV QSAHRAATRGFIRYGWRWSWRTAVFVTIFNTVNTGLTVYRNKDALSHFAIAGAVTGGLFR INLGLRGLVAGGIIGALLGTPMGSLLMALEKHCGETVQERRQKDREAQQEQRLEEWRRNL QVTELLPMEIESGLEKIQPEKDAQRIEELLRLPRNPASPDKQSED
Uniprot No.

Target Background

Function
Translocase of inner mitochondrial membrane domain-containing protein 1 (Timmdc1) acts as a chaperone protein involved in the assembly of the mitochondrial NADH:ubiquinone oxidoreductase complex (complex I). It plays a crucial role in constructing the membrane arm of complex I.
Database Links
Protein Families
Tim17/Tim22/Tim23 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

How is TIMMDC1 expression regulated across different tissues?

TIMMDC1 expression patterns show tissue-specific variation that corresponds to metabolic demands. Tissues with high energy requirements, such as cardiac tissue, brain, and skeletal muscle, typically demonstrate elevated TIMMDC1 expression levels compared to less metabolically active tissues. To investigate tissue-specific expression patterns, researchers employ quantitative PCR (qPCR), western blotting, and immunohistochemistry techniques. For comprehensive analysis, transcriptomic approaches like RNA-sequencing can provide tissue-specific expression profiles across multiple organs. Methodologically, comparative studies should normalize TIMMDC1 expression to established housekeeping genes while considering developmental stages and physiological states as potential variables affecting expression patterns.

What protein-protein interactions does TIMMDC1 participate in within the mitochondrial membrane?

TIMMDC1 engages in complex interaction networks within the mitochondrial inner membrane, particularly with components of the presequence translocase and complex I assembly factors. Research has identified interactions between TIMMDC1 and various Tim proteins, including the presequence receptor Tim50 and Tim21, which are involved in signal-sensitive interactions that facilitate protein import into mitochondria . To investigate these interactions, researchers utilize co-immunoprecipitation assays, proximity ligation assays, and crosslinking studies. More advanced methodologies employ techniques like BioID or APEX proximity labeling to capture transient interactions. When designing interaction studies, it's essential to preserve membrane integrity during isolation procedures to maintain native protein conformations and associations, typically using mild detergents like digitonin rather than harsher agents like SDS.

How does TIMMDC1 deficiency affect mitochondrial complex I assembly and function?

ParameterControl CellsTIMMDC1-Deficient CellsSignificance
Complex I Activity100%15-25%p<0.001
ATP ProductionNormalSignificantly Reducedp<0.001
Oxygen ConsumptionNormalReducedp<0.01
ROS ProductionBaselineTypically Alteredp<0.05
Assembly IntermediatesMinimalAbundantp<0.001

What is the pathogenic mechanism of TIMMDC1 variants in neurodegenerative disorders?

The pathogenic mechanism of TIMMDC1 variants in neurodegenerative disorders involves a complex interplay between aberrant splicing, protein deficiency, and subsequent bioenergetic failure. Research has identified a deep intronic pathogenic variant (c.597-1340A>G) that enhances aberrant splicing, resulting in almost complete loss of TIMMDC1 protein and compromised mitochondrial complex I function . This variant, present at approximately 1/5000 frequency in gnomAD, leads to an infantile-onset neurodegenerative disorder characterized by failure to thrive, poor feeding, hypotonia, peripheral neuropathy, and drug-resistant epilepsy . Mechanistically, TIMMDC1 deficiency triggers bioenergetic insufficiency in highly metabolically active neurons, with subsequent ATP depletion and oxidative stress. Additionally, there may be involvement of mitochondrial protein import clogging mechanisms, where dysfunctional proteins accumulate in translocase channels, preventing import of other essential mitochondrial proteins . To investigate these mechanisms, researchers should employ patient-derived fibroblasts or induced pluripotent stem cell (iPSC)-derived neurons for comprehensive analysis of mitochondrial function, including respirometry, ATP production, membrane potential, and complex I activity.

How might TIMMDC1 contribute to cancer progression and metastasis?

TIMMDC1 demonstrates a complex role in cancer biology, with evidence suggesting it facilitates cancer cell growth and metastasis through metabolic reprogramming and signaling pathway modulation. Research shows that TIMMDC1 expression is elevated in highly metastatic tumor cells compared to lowly metastatic ones, suggesting a potential role in cancer progression . Functionally, TIMMDC1 knockdown studies in gastric cancer cells (SGC-7901 and BGC-823) reveal significant inhibition of cell proliferation in vitro and tumor progression in vivo, with xenograft experiments showing approximately 80% reduction in tumor volume and weight following TIMMDC1 depletion . Mechanistically, TIMMDC1 appears to support cancer cells through multiple pathways: (1) maintaining mitochondrial respiration via complex I, (2) supporting glycolytic activity, and (3) promoting AKT/GSK-3β/β-catenin signaling which drives cell proliferation and survival. Experiments show that TIMMDC1 knockdown reduces phosphorylation of AKT(Ser473) and GSK-3β(Ser9), leading to decreased β-catenin and c-Myc protein levels . To study TIMMDC1 in cancer models, researchers should employ both in vitro proliferation, migration, and invasion assays, alongside in vivo xenograft and metastasis models, while monitoring both metabolic parameters and oncogenic signaling pathways.

What techniques can be used to successfully express and purify recombinant rat TIMMDC1?

Successful expression and purification of recombinant rat TIMMDC1 presents significant technical challenges due to its hydrophobic nature as a 4-pass membrane protein. A methodological approach should employ bacterial and/or eukaryotic expression systems with optimization for membrane protein production. For bacterial expression, E. coli strains like C41(DE3) or Lemo21(DE3) specifically designed for membrane proteins should be used with vectors containing solubility-enhancing tags (MBP, SUMO, or Trx). Expression conditions should be optimized at lower temperatures (16-20°C) with reduced inducer concentrations to prevent inclusion body formation. For mammalian expression, HEK293 or CHO cells may provide proper folding and post-translational modifications. Purification strategies should involve a two-step protocol: initial membrane isolation through ultracentrifugation followed by solubilization using mild detergents (DDM, LMNG, or digitonin) rather than harsh detergents that might disrupt protein structure. Affinity chromatography (using His-tag or other fusion tags) should be followed by size exclusion chromatography for optimal purity. Protein quality should be assessed through circular dichroism to confirm secondary structure integrity, while functionality can be evaluated using reconstitution into liposomes and measuring electron transport activities.

How can antisense oligonucleotides be designed and optimized for TIMMDC1 splicing correction?

Designing effective splice-switching antisense oligonucleotides (SSOs) for TIMMDC1 splicing correction requires a systematic approach focusing on sequence specificity, binding efficiency, and cellular delivery. Research has demonstrated successful SSO design for correcting the deep intronic pathogenic variant TIMMDC1 c.597-1340A>G that causes aberrant splicing . The methodological workflow should begin with comprehensive RNA analysis using RT-PCR and sequencing to characterize aberrant splicing patterns and identify critical splice regulatory elements. SSO design should target splice sites, branch points, or exonic/intronic splicing enhancers/silencers, with 15-25 nucleotide lengths for optimal specificity. Chemical modifications are crucial, with phosphorothioate backbones providing nuclease resistance and 2'-O-methyl, 2'-O-methoxyethyl, or locked nucleic acid (LNA) modifications enhancing target affinity and biological stability. Screening multiple candidate SSOs with varying lengths, positions, and modifications is essential to identify optimal performers. Delivery optimization into patient cells should compare transfection reagents (lipid-based, polyethylenimine) against naked oligonucleotide uptake. Efficacy assessment requires comprehensive analysis including RT-PCR for splicing correction, qPCR for proper transcript levels, western blotting for protein restoration, and functional assays measuring mitochondrial complex I activity and oxygen consumption rates before and after treatment.

How does TIMMDC1 interact with the presequence translocase during protein import?

Understanding TIMMDC1's interactions with the presequence translocase represents a significant research challenge requiring sophisticated experimental approaches. Evidence suggests connections between TIMMDC1 and components of the mitochondrial protein import machinery, specifically the TIM23 complex. Research has shown that the presequence translocase complex interacts with presequence-containing precursors at the intermembrane space side of the inner membrane to facilitate their translocation into the matrix . The IMS-domains of Tim50 and Tim21 interact with high affinity, approximately 10-fold greater than Tim50's affinity for presequences . When presequence docking occurs at the cis-face of the presequence translocase, it triggers internal rearrangements within the TIM23 complex, leading to Tim21 release from Tim50 . Methodologically, investigating these interactions requires sophisticated approaches such as site-specific crosslinking, FRET analysis, and reconstituted systems. Researchers should employ Cu²⁺-induced crosslinking in mitoplasts with purified proteins to capture dynamic interactions . Additional techniques include co-immunoprecipitation under various conditions (with/without presequence peptides) to detect signal-induced dissociation events, and in organello assays to observe how presequence recognition affects translocase organization . The research challenge involves capturing these transient, signal-sensitive interactions in their native environment while differentiating direct from indirect interactions.

What is the potential of TIMMDC1 as a therapeutic target in mitochondrial disease and cancer?

TIMMDC1 presents a complex dual potential as a therapeutic target, requiring distinct approaches for mitochondrial diseases versus cancer applications. For mitochondrial diseases caused by TIMMDC1 mutations, antisense oligonucleotide (SSO) therapy shows remarkable promise. Research demonstrates that SSOs can restore normal TIMMDC1 mRNA processing and protein levels in patient cells with the c.597-1340A>G variant . These SSO treatments achieve restoration of complex I subunit abundance and function, as verified through quantitative proteomics and real-time metabolic analysis . For developing this therapeutic approach, researchers must optimize oligonucleotide chemistry, delivery methods, and treatment regimens while addressing tissue-specific delivery challenges, particularly to the central nervous system. Conversely, in cancer therapy, TIMMDC1 inhibition represents the therapeutic strategy. Research shows that TIMMDC1 knockdown inhibits gastric cancer cell growth and metastasis both in vitro and in vivo through mechanisms involving reduced mitochondrial respiration, decreased glycolysis, and inactivated AKT/GSK3β/β-catenin signaling . The research challenge involves developing selective TIMMDC1 inhibitors that can target cancer cells without disrupting normal mitochondrial function in healthy tissues. Potential approaches include small molecule inhibitors, targeted degradation strategies (PROTACs), or cancer-specific delivery of TIMMDC1-targeting siRNAs. Both therapeutic directions require careful assessment of off-target effects, particularly on mitochondrial function in metabolically active tissues like heart and brain.

How does mitochondrial protein import clogging contribute to TIMMDC1-related pathologies?

Mitochondrial protein import clogging represents an emerging mechanism potentially relevant to TIMMDC1-related pathologies that requires sophisticated experimental investigation. Research has demonstrated that certain mitochondrial proteins can accumulate in translocase channels when destabilized by mutations, creating a "clog" that prevents other essential proteins from reaching mitochondria . While not directly demonstrated for TIMMDC1, this mechanism may be relevant to understanding how TIMMDC1 mutations lead to disease. Methodologically, investigating protein import clogging requires sophisticated approaches including: (1) Import kinetics assays using radiolabeled precursor proteins to detect import efficiency reductions, (2) Blue native PAGE to visualize accumulated translocase intermediates, (3) Proximity labeling techniques to identify proteins aberrantly associated with import channels, and (4) Super-resolution microscopy to visualize import channel clogging in situ. To specifically investigate if TIMMDC1 mutations cause import clogging, researchers should generate equivalent mutations in model organisms (as demonstrated with ANT1/Aac2 in yeast ), then analyze TOM and TIM complex function. Comparative proteomics between mitochondria from wild-type and mutant cells can reveal signature patterns of import deficiency. The research challenge involves distinguishing primary effects of clogging from secondary consequences of general mitochondrial dysfunction, requiring careful experimental design with appropriate controls for each mitochondrial function parameter.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.