Recombinant Rat Translocator protein (Tspo)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Physiology

TSPO mediates mitochondrial cholesterol import, the rate-limiting step for steroidogenesis. Its roles include:

  • Steroid Hormone Synthesis: Facilitates cholesterol transport to the inner mitochondrial membrane for pregnenolone production .

  • Neurosteroid Regulation: Critical for brain allopregnanolone synthesis, impacting stress and anxiety responses .

  • Mitochondrial Permeability Transition Pore (mPTP): Modulates apoptosis via interactions with VDAC and adenine nucleotide translocator .

Research Findings from Rat Models

Genetic and pharmacological studies in rats highlight TSPO's physiological significance:

3.1. Tspo Knockout (KO) Models

Two rat KO lines were generated using zinc finger nucleases (ZFNs) :

ModelGenetic ModificationPhenotypic Outcomes
Rat589-bp deletion in exon 3/intron 3 junction- No TSPO protein expression
- Reduced ACTH-induced corticosterone response
Rat7164-bp deletion in TM5 (including CRAC motif)- Truncated TSPO protein
- Undetectable neurosteroids (e.g., allopregnanolone)

Both models showed:

  • Accumulation of cholesteryl esters in adrenal glands, testes, and ovaries .

  • Attenuated testosterone production and stress hormone responses .

3.2. Pharmacological Activation

TSPO ligands restore steroidogenic capacity in aged Leydig cells:

  • FGIN-1-27 and Ro5-4864 increased testosterone production in vitro by 2–3 fold .

  • In vivo administration of FGIN-1-27 (1 mg/kg) elevated serum testosterone in aged rats to levels comparable to young rats .

Clinical and Therapeutic Implications

  • Human Polymorphism (rs6971): The Thr147 variant reduces cortisol response to ACTH by 30–40%, mimicking rat KO phenotypes .

  • Neuropsychiatric Disorders: TSPO ligands (e.g., AC-5216) increase neurosteroids like allopregnanolone, showing promise for PTSD and anxiety .

Controversies and Future Directions

Despite pharmacological evidence supporting TSPO’s role in steroidogenesis, genetic KO studies in mice and rats show partial functional redundancy, suggesting compensatory mechanisms . Future research should focus on:

  • Tissue-specific TSPO functions.

  • Structural dynamics of ligand-bound TSPO.

  • Development of isoform-specific ligands for therapeutic targeting.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during production. If you have a preferred tag type, please inform us, and we will prioritize developing it for your order.
Synonyms
Tspo; Bzrp; Mbr; Translocator protein; Mitochondrial benzodiazepine receptor; PKBS; Peripheral-type benzodiazepine receptor; PBR
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-169
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
Uniprot No.

Target Background

Function
This protein facilitates the transport of cholesterol across mitochondrial membranes and may be involved in lipid metabolism. However, its precise physiological role is subject to debate. It is apparently not essential for steroid hormone biosynthesis. It can bind protoporphyrin IX and may play a role in the transport of porphyrins and heme. Initially identified as a peripheral-type benzodiazepine receptor, it can also bind isoquinoline carboxamides.
Gene References Into Functions
  1. These findings suggest that the imidazole[1,2-a]pyridine-based radiotracer [(18)F]2 is a sensitive tool for non-invasively diagnosing myocarditis related to inflammation of the heart muscle by assessing abnormal TSPO expression. PMID: 29342117
  2. Data indicate that this protein (18kDa) (TSPO) may represent a novel therapeutic target for depression in type 2 diabetes mellitus (T2DM). PMID: 27886206
  3. TSPO mutations in rats and a human polymorphism impair the rate of steroid synthesis. PMID: 29074640
  4. This study demonstrates that the neuronal protection mediated by Ro5-4864 in brain injury, as described in previous research, cannot be solely attributed to an indirect effect of the ligand on glial TSPO but may also represent the consequence of upregulation of TSPO expression in injured neurons. PMID: 27223627
  5. Results suggest that allopregnanolone synthesis is induced by sequential activation of translocator protein 18 kD (TSPO) and 5alpha-reductase in an ex vivo glaucoma model, and that TSPO agonists may serve as potential therapeutic agents for the prevention of pressure-induced retinal damage. PMID: 27596950
  6. Results indicate that in the acute phase after spinal cord injury, the increased expression of 18kDa translocator protein and 5alpha-reductase may represent a protective endogenous response against tissue injury. PMID: 27150077
  7. TSPO mRNA liver levels increased with the severity of liver damage. PMID: 26612465
  8. Estradiol action at the membrane leads to the augmentation of neuroprogesterone synthesis through increasing cAMP, activation of protein kinase A, and the phosphorylation of TSPO and StAR in hypothalamic astrocytes. PMID: 24877623
  9. Data indicate that benzoxazolone derivative showed affinity binding with 18 kDa translocator protein (TSPO). PMID: 24050790
  10. TSPO ligand 4'-chlorodiazepam inhibits oxidative stress and oxysterol formation by reducing the accumulation of cholesterol in the mitochondrial matrix to prevent myocardial ischemia reperfusion injury. PMID: 23554458
  11. Results suggest that although there are reduced amounts of translocator protein (TSPO) in aged Leydig cells. PMID: 23525219
  12. We report that TSPO was upregulated in astrocytes and microglia in the ipsilateral spinal dorsal horn of rats following L5 spinal nerve ligation PMID: 23345228
  13. Data indicate that an increase in TSPO expression was primarily observed in the neutrophils and macrophages of inflamed lungs. PMID: 22984611
  14. There is a difference between immature and adult brain in the appearance of withdrawal symptoms after administration of the partial agonist of benzodiazepine receptors Ro 19-8022. PMID: 22816377
  15. TSPO's strong expression in dividing spermatogonia suggests that it might play a role in spermatogonial mitosis. PMID: 22348614
  16. Data suggest that the species-specificity of norbormide toward the rat translocator protein, TSPO, depends on subtle differences in the structure of TSPO or of TSPO-associated proteins affecting its substrate specificity. PMID: 21889488
  17. We have demonstrated that after a stressful stimulus, we could observe a general modification of the adipose tissue morphology and an increased expression of PPAR-gamma and TSPO 18-kDa. PMID: 20948513
  18. Novel androstenetriol interacts with the mitochondrial translocator protein and controls steroidogenesis. PMID: 21209087
  19. Clinical consequences of secondary neuronal degeneration in stroke might be better treated thanks to the discrimination of neuronal processes using in vivo molecular imaging and potent TSPO radioligands like CLINDE to guide therapeutic interventions. PMID: 20814674
  20. The permeability transition is an inner membrane mitochondrial event that is regulated by the outer membrane through specific interactions with TSPO PMID: 21062740
  21. DMBA induced oxidative stress in the liver correlating with decreases in TSPO binding capacity in the livers. PMID: 21037200
  22. Peripheral-type benzodiazepine receptor (PBR) antagonist may be a potential therapeutic agent for the control of aggressiveness of breast cancer. PMID: 20204676
  23. Peripheral-type benzodiazepine receptor (PBR) protein was increased at 6 and 7 days of age in pups exposed to hypoxia from birth. PMID: 12388447
  24. Mucous and parietal cells of the gastric mucosa express mitochondrial peripheral-type benzodiazepine receptor functionally coupled to Ca(2+)-dependent Cl(-) secretion, possibly involved in the gastric mucosa protection. PMID: 14726306
  25. ACTH has significant, but reversible, effects on the development of adrenocortical function, possibly mediated in part by increased expression of peripheral benzodiazepine receptor PMID: 14962996
  26. Enhanced expression of peripheral benzodiapine receptor provides a mechanism to increase apoptotic rates of cancer cells. PMID: 16026165
  27. Involved in early regenerative response of small caliber sensory axons, the preconditioning effect, and shows that PBR agonists enhance sensory axon regeneration. PMID: 16099172
  28. Reaction of neuronal nitrate synthase over the time of changes in Leydig cell steroidogenic acute regulatory protein and the peripheral-type benzodiazepine receptor. PMID: 16239298
  29. This study provides evidence for PBR involvement in PTP opening, controlling the Ca2+-induced Ca2+ efflux, and AIF release from mitochondria, important stages of initiation of programmed cell death. PMID: 17174393
  30. The present findings collectively support the utility of PBR in identifying a unique temporal pattern of astrocytic and microglial activation that conventional glial markers hardly pursue. PMID: 17540348
  31. These results indicate that DAA1106 binds with higher affinity to microglia in rat models of neuroinflammation when compared with PK11195. PMID: 17555551
  32. These findings identify TSPO as a potential target for controlling neural inflammation, showing that the TSPO ligand PK11195 may reduce microglia activation by a mechanism that is independent of the regulation of neuronal survival. PMID: 17674368
  33. Important role of 18-kDa translocator protein in the mechanism of ammonia neurotoxicity. PMID: 17893919
  34. Thus, [(11)C]AC-5216 is a promising PET ligand for imaging PBR in a brain with neuroinflammation. PMID: 17959307
  35. TSPO potentiates proliferation, motility and transmigration capabilities as well as the ability to overcome contact-induced cell growth inhibition of glioma cells. PMID: 18190798
  36. High-affinity ligand binding to mitochondrial Bzrp modulates neurotransmitter-induced salivary secretion by duct and mucous acinar cells of rat submandibular glands. PMID: 18269350
  37. These results suggest that [(11)C]PK-11195 PET imaging would be a useful tool for evaluating microglial activation in a rat brain injury model. PMID: 18600420
  38. PET tracers [11C]-DPA-713 and [18F]-DPA were evaluated for TSPO in a rat model of herpes encephalitis. PMID: 19330384
  39. In rat intestine, TSPO is found in mitochondria of enterocytes but not goblet cells. Affinity of TSPO for various ligands varied in duodenum, jejunum, ileum, myocardium, adrenals, and submandibular glands. TSPO exhibited highest affinity for PK 11195. PMID: 19392661
  40. PBR binding to its ligands induced pore and phosphorylation of 3.5-kDa polypeptide in rat brain mitochondria. PMID: 19463096
  41. Ovariectomy causes a significant decrease in uterine, but not renal TSPO binding density, while estradiol treatment of ovariectomized rats restored TSPO binding density in the uterus. PMID: 19524125
  42. Spinal TSPO is involved in the development and maintenance of inflammatory pain behaviors in rats PMID: 19555675

Show More

Hide All

Database Links

KEGG: rno:24230

STRING: 10116.ENSRNOP00000014089

UniGene: Rn.1820

Protein Families
TspO/BZRP family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein. Membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in adrenal gland.

Q&A

What is TSPO and what are its primary functions in rat models?

TSPO (Translocator protein, 18 kDa) is a ubiquitous conserved outer mitochondrial membrane protein containing five transmembrane domains. It is implicated in numerous cell and tissue functions, including steroid hormone biosynthesis, respiration, cell proliferation, and apoptosis. In rat models, TSPO binds with high affinity to cholesterol and numerous compounds, is expressed at high levels in steroid-synthesizing tissues such as the adrenal cortex, and mediates cholesterol import into mitochondria, which is the rate-limiting step in steroid formation . This protein plays crucial roles in glucocorticoid and mineralocorticoid steroid hormone synthesis, which are essential for mammalian development, physiology, stress response, immune function, and brain function. Understanding TSPO in rat models provides valuable insights into these physiological processes.

How does rat TSPO differ structurally and functionally from human TSPO?

Rat TSPO shares significant structural homology with human TSPO but demonstrates important species-specific differences. The most notable difference is related to the binding domain - in humans, the rs6971 polymorphism leads to an amino acid substitution in the fifth transmembrane loop of the protein, specifically in the cholesterol-binding domain . This polymorphism has been associated with anxiety-related disorders in humans. Functionally, research has shown that TSPO deletion mutations in rats and the corresponding rs6971 polymorphism in humans alter adrenocorticotropic hormone-induced plasma corticosteroid concentrations . Rat tissues with TSPO mutations show increased cholesteryl ester accumulation, and neurosteroid formation becomes undetectable in homozygous rats, suggesting distinct functional attributes between species that should be considered when translating research findings.

What are the expression patterns of TSPO in different rat tissues?

TSPO is widely expressed across rat tissues but shows notably high expression in steroid-synthesizing tissues, particularly the adrenal cortex . Moderate expression levels are typically observed in microglia, where it serves as a commonly used marker for neuroinflammation. Research indicates that in resting microglia, rat cells demonstrate moderate TSPO mRNA expression levels, allowing it to be detected and quantified in various experimental paradigms . The expression pattern can be altered by various stimuli, though interestingly, certain treatments like TGFβ1 do not significantly alter TSPO gene expression in either rat or mouse microglia . This differential expression pattern across tissues makes TSPO a valuable target for studying tissue-specific functions in rat models.

What are the recommended methods for quantifying rat TSPO expression?

For quantifying rat TSPO expression, researchers typically employ multiple complementary techniques to ensure robust and accurate measurements. Quantitative PCR (qPCR) is commonly used for measuring TSPO mRNA levels, with appropriate reference genes for normalization. For protein-level quantification, Western blotting with specific antibodies against rat TSPO provides reliable detection. ELISA-based methods using pre-coated plates with antibodies specific to TSPO allow for more quantitative analysis . Importantly, when designing qPCR experiments for TSPO, primers should target conserved regions to ensure specificity. For immunological detection methods, validation of antibody specificity is critical since cross-reactivity between species can occur despite sequence differences. Researchers should also consider tissue-specific expression variations when interpreting results, as baseline TSPO levels differ significantly between tissues such as adrenal glands versus brain tissue.

How should researchers prepare functional recombinant rat TSPO for in vitro studies?

When preparing functional recombinant rat TSPO for in vitro studies, researchers should consider several critical factors. First, the expression system selection is crucial - bacterial systems (E. coli) are commonly used for basic protein production, but mammalian expression systems may provide better post-translational modifications relevant to TSPO function. The purification strategy should account for TSPO's hydrophobic nature as a transmembrane protein, typically requiring detergent solubilization and careful buffer optimization to maintain protein stability and functionality. Researchers should verify protein integrity through size-exclusion chromatography, SDS-PAGE, and functional binding assays. For functional validation, cholesterol binding assays are essential since cholesterol binding is a key property of TSPO . Additionally, reconstitution into artificial membrane systems like liposomes or nanodiscs may be necessary to study TSPO in a membrane environment that mimics its native state.

What concentration ranges of recombinant rat TSPO are typically used in experimental settings?

The appropriate concentration of recombinant rat TSPO varies depending on the specific experimental application. Based on comparable studies with other recombinant proteins like CNTF, where the effective dose (ED₅₀) ranges from 0.1-0.3 ng/mL to 3-15 ng/mL depending on the bioassay , researchers typically use recombinant TSPO in the nanogram to microgram per milliliter range. For binding studies examining interactions with ligands or cholesterol, lower concentrations (1-50 ng/mL) are often sufficient. For functional studies examining TSPO's impact on steroidogenesis or mitochondrial function, higher concentrations (50-500 ng/mL) may be required to observe significant effects. When used in cell culture systems, researchers should conduct dose-response experiments to determine the optimal concentration, as excessive concentrations may lead to non-specific effects or toxicity. Preliminary titration experiments are strongly recommended to establish the minimum effective concentration for each specific experimental system.

What methodological approaches allow for direct comparison between rat and human TSPO function?

To directly compare rat and human TSPO function, researchers should implement parallel methodological approaches that minimize experimental variables while highlighting species-specific differences. Recombinant protein studies represent a foundational approach - expressing both rat and human TSPO (including human polymorphic variants) in identical expression systems allows direct comparison of structural properties, ligand binding affinities, and cholesterol transport capacity. Cell-based systems using identical host cells (typically human cell lines like HEK293) transfected with either rat or human TSPO enable assessment of functional differences in consistent cellular environments. For steroidogenesis studies, heterologous expression in steroid-producing cells followed by quantification of steroid production using LC-MS/MS provides direct functional comparisons. Advanced techniques like hydrogen-deuterium exchange mass spectrometry can reveal subtle structural differences in protein dynamics between species. For translational relevance, dual-species pharmacological studies should test identical compounds across rat and human TSPO to identify species-specific binding profiles and efficacy differences. Finally, computational approaches including molecular dynamics simulations of both proteins can predict functional differences based on structural variations. When conducting these comparative studies, it's essential to consider the human rs6971 polymorphism , as this genetic variation significantly impacts ligand binding and may explain some observed functional differences.

What are the common pitfalls in generating and validating recombinant rat TSPO?

Researchers encounter several challenges when generating and validating recombinant rat TSPO. First, expression system selection can significantly impact protein quality - bacterial systems often yield high quantities but may lack critical post-translational modifications, while mammalian systems produce more native-like protein but with lower yields. Solubility issues frequently arise due to TSPO's hydrophobic nature as a transmembrane protein, requiring careful optimization of detergents and buffer conditions to maintain stability without disrupting function. Protein aggregation during purification is common and can be mitigated through addition of stabilizing agents and careful temperature control. Validation pitfalls include inadequate confirmation of structural integrity - researchers should employ multiple techniques (circular dichroism, tryptophan fluorescence, limited proteolysis) beyond simple SDS-PAGE to verify proper folding. Functional validation often fails when using inappropriate binding assays - cholesterol binding studies require specialized techniques accounting for the hydrophobic nature of both protein and ligand. Batch-to-batch variability can significantly impact experimental reproducibility, necessitating rigorous quality control measures for each preparation. Finally, many commercial antibodies show cross-reactivity with other proteins, requiring thorough validation before use in detecting recombinant rat TSPO .

What factors should be considered when comparing results from different experimental models of rat TSPO?

When comparing results across different experimental models of rat TSPO, researchers must consider several critical factors that influence experimental outcomes. First, the genetic background of rat strains significantly impacts TSPO expression and function - different strains may exhibit variable baseline expression levels and functional responses to identical stimuli. The specific tissue or cell type under investigation introduces another variable, as TSPO expression and function vary considerably between steroidogenic tissues, microglia, and other cell types . Age-dependent effects are particularly important, as TSPO expression and function change throughout development and aging. The specific model system (in vitro cell culture, ex vivo tissue preparations, or in vivo models) introduces unique variables that affect interpretation - for instance, microglia in culture may respond differently to stimuli compared to those in intact brain tissue . The experimental readout selection is crucial, as measuring different endpoints (mRNA levels, protein expression, ligand binding, or downstream functional effects) may yield seemingly contradictory results reflecting different aspects of TSPO biology. Environmental factors including housing conditions, stress levels, and circadian timing affect TSPO expression and function in vivo. Finally, the specific methodological details for recombinant protein preparation significantly impact protein quality and function . To address these variables, researchers should implement standardized protocols, include appropriate controls for each experimental variable, and clearly report all methodological details to facilitate accurate comparison across studies.

What are the future directions for recombinant rat TSPO research?

Future research on recombinant rat TSPO should focus on several promising directions to advance our understanding of this important protein. Development of improved expression and purification methodologies will be crucial for obtaining higher-quality recombinant protein with preserved native structure and function. Structure-function studies comparing rat TSPO with human variants, particularly the rs6971 polymorphism , will provide valuable insights into species-specific differences and their implications for translational research. The creation of more sophisticated conditional and tissue-specific knockout rat models will help resolve current inconsistencies regarding TSPO's role in steroidogenesis and other functions. Advanced imaging techniques using fluorescently tagged recombinant TSPO will enable real-time visualization of its subcellular dynamics and interactions. Proteomics approaches identifying TSPO-interacting partners in different tissues will illuminate its diverse cellular functions beyond steroidogenesis. Systems biology approaches integrating transcriptomic, proteomic, and metabolomic data will help develop comprehensive models of TSPO's role in cellular networks. Development of novel, highly specific TSPO ligands based on species-specific structural insights will enable more precise pharmacological manipulation. Finally, translational studies comparing rat, mouse, and human TSPO will be essential for understanding the relevance of animal models to human health and disease, particularly in neuropsychiatric conditions where the rs6971 polymorphism has been implicated in anxiety-related disorders .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.