Recombinant Rat Transmembrane 4 L6 family member 4 (Tm4sf4)

Shipped with Ice Packs
In Stock

Description

Biological Functions

Tm4sf4 regulates cell adhesion, migration, and differentiation through interactions with integrins, growth factors, and signaling receptors . Key roles include:

  • Pancreatic Development: Modulates endocrine cell fate decisions by inhibiting α/β-cell specification while promoting ε-cell differentiation in zebrafish .

  • Liver Regeneration: Upregulated during liver injury (e.g., CCl4-induced damage) and regeneration, accelerating hepatocyte apoptosis via TNF-α and HGF/c-met pathways .

  • Cancer Progression: Overexpressed in hepatocellular carcinoma (HCC), promoting mitochondrial oxidative phosphorylation and tumorigenesis .

Role in Liver Injury

  • Mechanism: Overexpression of Tm4sf4 in CCl4-treated rats exacerbates liver necrosis, elevates serum ALT/AST levels, and dysregulates apoptosis-related genes (Bax, Bcl-2) .

  • Pathway Modulation: Enhances TNF-α/TNFR1 signaling while suppressing c-met expression .

Cancer Implications

  • HCC: Tm4sf4 is a top-ranked therapeutic target in HCC due to its high tumor-specific expression and association with mitochondrial oncogenic pathways .

  • Chemoresistance: Silencing Tm4sf4 reverses cancer cell proliferation and migration in preclinical models .

Cell Signaling Interactions

  • Thiamine Transport: Interacts with human thiamine transporter-2 (hTHTR-2) in intestinal cells, enhancing thiamine uptake .

  • Rho Signaling: Inhibits Rho-activated cell migration independently of ROCK pathways .

Experimental Models

ModelApplication
ZebrafishStudy endocrine pancreas differentiation
Rat Liver InjuryInvestigate regenerative mechanisms and fibrosis
Cancer Cell LinesEvaluate Tm4sf4-driven chemoresistance and metastasis

Therapeutic Potential

  • Antibody Development: Anti-Tm4sf4 antibodies inhibit tumor progression in preclinical HCC models .

  • Gene Silencing: siRNA-mediated knockdown reduces thiamine uptake and cancer cell viability .

Future Directions

  • Clinical Translation: Validate Tm4sf4 as a biomarker for HCC diagnosis or therapeutic target .

  • Mechanistic Studies: Elucidate its role in mitochondrial metabolism and cross-talk with integrins .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate this to us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
Tm4sf4; Lrtm4; Transmembrane 4 L6 family member 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Tm4sf4
Target Protein Sequence
MCTGGCARCLGGTLIPLAVFAVLANILLFFPGGKVVDDNSHLSDEVWYFGGILGSGVLMI FPALVFLGLQNNDCCGCCGNESCGKRFAMFTSTLFAVVGFLGAAYSFIVSAVSINKGPKC FMTNNTWGYPFHDGDYLNDQALWSKCEEPRDVVPWNLTLFSILLVIGGIQMVLCAIQVIN GLLGTLCGDCQCCGCCGGDRPV
Uniprot No.

Target Background

Function
Regulates the adhesive and proliferative status of intestinal epithelial cells. It can mediate density-dependent cell proliferation.
Gene References Into Functions
  1. Rat TM4SF4 is overexpressed in acutely injured liver induced by CCl4 and plays a crucial role in accelerating liver injury. This may be mediated by the TNF-alpha and HGF/c-met signaling pathways. PMID: 17069928
Database Links
Protein Families
L6 tetraspanin family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in liver and testis. Up-regulated in regenerating liver after partial hepatectomy.

Q&A

What is Tm4sf4 and to which protein family does it belong?

Tm4sf4 (Transmembrane 4 L6 Family Member 4) is a multi-pass membrane glycoprotein that belongs to the transmembrane 4 superfamily (TM4SF), also known as the tetraspanin family. It is specifically grouped under the transmembrane 4 L6 domain family along with TM4SF1 and TM4SF5. The TM4SF family consists of six members with similar topology and sequence homology, including TM4SF1/L6-Ag, TM4SF4/IL-TMP, TM4SF5/L6H, TM4SF18/L6D, TM4SF19/OCTM4, and TM4SF20/TCCE518 . Tm4sf4 has approximately 50% sequence identity with other L6 proteins but is notably deficient in the characteristic cysteine residue motifs in the EC2 transmembrane domain of the long extracellular hydrophilic loop, suggesting potentially distinct functions compared to other family members .

What are the known physiological roles of Tm4sf4?

Tm4sf4 has been implicated in several important physiological processes. It plays regulatory roles in tissue differentiation, signal transduction pathways, cellular activation, proliferation, motility, adhesion, and angiogenesis. Increased levels of Tm4sf4 have been specifically detected in non-dividing epithelial intestinal cells and hepatocytes, where it is responsible for cellular differentiation and migration . Research indicates that Tm4sf4 and other TM4SF members interact with different integrins and receptors to induce intracellular signaling cascades that regulate various cellular functions .

What are the optimal conditions for storing and reconstituting recombinant rat Tm4sf4?

Recombinant rat Tm4sf4 protein is typically supplied as a lyophilized powder and requires proper storage and reconstitution for optimal experimental use. The recommended storage conditions are:

Storage ConditionRecommendation
Long-term storage-20°C to -80°C
Working aliquots4°C for up to one week
Storage bufferTris/PBS-based buffer, 6% Trehalose, pH 8.0

For reconstitution, follow these steps:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to 5-50% final concentration (50% is commonly used)

  • Aliquot for long-term storage at -20°C to -80°C

Importantly, repeated freeze-thaw cycles should be avoided as they can compromise protein integrity and activity .

What expression systems are recommended for producing recombinant rat Tm4sf4?

  • For structural and functional studies requiring native conformation, mammalian or insect cell expression systems may provide better post-translational modifications and proper folding than bacterial systems.

  • For applications requiring large quantities of protein, bacterial expression systems like E. coli remain cost-effective, though optimization of expression conditions (temperature, induction time, media composition) may be necessary.

  • For studies of protein-protein interactions, baculovirus-insect cell systems offer a compromise between proper folding and expression levels.

The choice of expression system should be dictated by the specific experimental requirements and downstream applications .

What purification methods yield the highest purity for recombinant rat Tm4sf4?

For His-tagged recombinant rat Tm4sf4, immobilized metal affinity chromatography (IMAC) is the primary purification method. This typically results in preparations with greater than 90% purity as determined by SDS-PAGE . For higher purity, a multi-step purification protocol is recommended:

  • Initial capture using Ni-NTA or TALON resin (for His-tagged protein)

  • Secondary purification using size exclusion chromatography to remove aggregates and degradation products

  • Optional ion exchange chromatography for removal of charged contaminants

For membrane proteins like Tm4sf4, the choice of detergents during extraction and purification is critical. Mild detergents such as n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) are generally suitable for maintaining protein structure and function. The purification buffer should typically contain detergent at concentrations above the critical micelle concentration (CMC) to maintain protein solubility .

How can researchers effectively study the role of Tm4sf4 in cancer progression?

Tm4sf4, like other members of the TM4SF family, has been implicated in cancer progression, particularly in hepatocellular carcinoma and colorectal cancer . Researchers can employ several methodological approaches to study its role:

  • Gene expression analysis:

    • RT-qPCR to quantify Tm4sf4 mRNA levels in cancer versus normal tissues

    • RNA-seq for genome-wide expression profiling

    • In situ hybridization to localize expression within tissue samples

  • Protein expression analysis:

    • Western blotting for quantitative analysis

    • Immunohistochemistry for spatial distribution in tissue sections

    • Flow cytometry for cell surface expression levels

  • Functional assays:

    • Gene silencing using siRNA or CRISPR-Cas9

    • Overexpression studies using transfection of expression vectors

    • Cell proliferation, migration, and invasion assays before and after Tm4sf4 modulation

    • Wound-healing assays to assess cell motility

  • Interaction studies:

    • Co-immunoprecipitation to identify binding partners

    • Proximity ligation assays to visualize protein-protein interactions in situ

    • Yeast two-hybrid or mammalian two-hybrid systems

  • In vivo studies:

    • Xenograft models with Tm4sf4-modulated cancer cells

    • Transgenic rodent models with altered Tm4sf4 expression

What are the established methodologies for studying Tm4sf4 interactions with integrins and other membrane receptors?

Studies have indicated that Tm4sf4 and related family members interact with integrins and other receptors to induce intracellular signaling. The following methodologies are recommended for investigating these interactions:

  • Biochemical approaches:

    • Pull-down assays using purified proteins

    • Surface plasmon resonance (SPR) for kinetic and affinity measurements

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

  • Cell-based assays:

    • FRET/BRET analysis for real-time protein interactions

    • Crosslinking studies followed by mass spectrometry

    • Co-localization analysis using confocal microscopy

  • Functional validation:

    • Competitive binding assays with known ligands

    • Mutational analysis of key domains

    • Signaling pathway activation studies using phospho-specific antibodies

    • Calcium flux assays for G-protein coupled receptor interactions

  • Computational approaches:

    • Molecular docking simulations

    • Molecular dynamics to model interaction stability

    • Protein-protein interaction network analysis

How can Tm4sf4 be utilized as a therapeutic target based on current research findings?

Research has demonstrated that TM4SF members, including Tm4sf4, have potential as therapeutic targets, particularly in cancer treatment. The following approaches can be considered:

  • Antibody-based therapies:

    • Development of neutralizing antibodies against extracellular domains

    • Antibody-drug conjugates for targeted delivery of cytotoxic agents

    • Bispecific antibodies targeting Tm4sf4 and immune cells

  • Small molecule inhibitors:

    • High-throughput screening for compounds disrupting Tm4sf4 interactions

    • Structure-based drug design targeting specific functional domains

    • Repurposing of existing drugs that may affect Tm4sf4 signaling

  • Gene therapy approaches:

    • siRNA or shRNA for Tm4sf4 knockdown

    • CRISPR-Cas9 gene editing to modify Tm4sf4 expression

    • Antisense oligonucleotides targeting Tm4sf4 mRNA

  • Combination therapies:

    • Targeting Tm4sf4 alongside standard chemotherapeutics

    • Combining with immune checkpoint inhibitors

    • Simultaneous targeting of multiple TM4SF family members

Preclinical studies have shown that gene silencing or anti-TM4SF antibodies can reverse the regulatory roles of these proteins in different cancer models, highlighting their therapeutic potential .

What mechanisms underlie the differential expression and function of Tm4sf4 in normal versus cancerous tissues?

The differential expression of Tm4sf4 between normal and cancerous tissues represents a complex interplay of regulatory mechanisms. Current evidence suggests several potential mechanisms:

  • Transcriptional regulation:

    • Altered activity of tissue-specific transcription factors

    • Epigenetic modifications including DNA methylation and histone modifications

    • Disruption of enhancer-promoter interactions in the chromatin landscape

  • Post-transcriptional regulation:

    • Changes in mRNA stability mediated by RNA-binding proteins

    • Altered microRNA targeting and expression profiles

    • Variations in alternative splicing patterns

  • Protein regulation:

    • Post-translational modifications affecting protein half-life

    • Altered trafficking to the cell membrane

    • Changes in protein-protein interaction networks

Methodologically, researchers can investigate these mechanisms using:

  • ChIP-seq for transcription factor binding and histone modifications

  • ATAC-seq for chromatin accessibility

  • RNA-seq with alternative splicing analysis

  • Protein mass spectrometry for post-translational modifications

  • Pulse-chase experiments for protein stability

Understanding these mechanisms could provide insights into both the physiological roles of Tm4sf4 and its contributions to pathological states .

How do the structural differences between Tm4sf4 and other TM4SF family members relate to their functional divergence?

Tm4sf4 has 50% sequence identity with other L6 proteins but notably lacks the characteristic cysteine residue motifs in the EC2 transmembrane domain that are present in other family members . This structural divergence likely contributes to functional specialization. Researchers investigating this question should consider:

  • Structure-function relationship analysis:

    • Site-directed mutagenesis of specific domains

    • Domain swapping between family members

    • Truncation studies to identify minimal functional units

    • Structural biology approaches including X-ray crystallography or cryo-EM

  • Comparative interactome analysis:

    • Identification of unique versus shared binding partners

    • Comparative affinity measurements for common interactors

    • Analysis of signaling pathway activation differences

  • Evolutionary analysis:

    • Phylogenetic studies across species

    • Identification of conserved versus divergent regions

    • Analysis of selection pressure on specific domains

  • Tissue-specific expression patterns:

    • Single-cell RNA-seq to identify cell-type specific expression

    • Comparison of regulatory elements across family members

    • Functional consequences of ectopic expression

These approaches would help elucidate how structural differences translate to functional specialization among TM4SF family members .

What is the role of Tm4sf4 in modulating the tumor microenvironment and how might this be exploited therapeutically?

Beyond its direct effects on cancer cells, Tm4sf4 may influence the tumor microenvironment. Research methodologies to investigate this area include:

  • Cell-cell interaction studies:

    • Co-culture systems with cancer cells and stromal components

    • 3D organoid models incorporating multiple cell types

    • Extracellular vesicle isolation and characterization

  • Immune modulation assessment:

    • Flow cytometric analysis of tumor-infiltrating immune cells

    • Cytokine/chemokine profiling in Tm4sf4-modulated systems

    • Immune cell functional assays (T cell activation, macrophage polarization)

  • Angiogenesis evaluation:

    • Endothelial tube formation assays

    • Chick chorioallantoic membrane (CAM) assays

    • Analysis of pro-angiogenic factor secretion

  • Extracellular matrix interaction:

    • Cell adhesion and invasion assays with different matrix components

    • Analysis of matrix metalloproteinase expression and activity

    • Atomic force microscopy for cell-matrix adhesion strength

Therapeutic exploitation could involve:

  • Disrupting Tm4sf4-mediated cancer-stromal cell interactions

  • Combining Tm4sf4 targeting with immunotherapies

  • Inhibiting specific downstream mediators identified in these studies

What are common challenges in working with recombinant Tm4sf4 and how can they be addressed?

As a multi-pass membrane protein, working with recombinant Tm4sf4 presents several technical challenges:

ChallengeSolution
Low expression levelsOptimize codon usage for expression system; Use stronger promoters; Adjust induction conditions (temperature, time, inducer concentration)
Protein aggregationScreen different detergents for solubilization; Add stabilizing agents (glycerol, specific lipids); Consider fusion partners to enhance solubility
Improper foldingUse mammalian or insect cell expression systems; Incorporate chaperone co-expression strategies; Optimize oxidizing/reducing conditions for disulfide bond formation
DegradationInclude protease inhibitors throughout purification; Minimize purification time; Identify and eliminate specific protease cleavage sites through mutagenesis
Loss of activity during storageAliquot to avoid freeze-thaw cycles; Test stabilizing additives (trehalose, glycerol); Consider lyophilization for long-term storage

Additionally, researchers should validate protein functionality after purification using binding assays, circular dichroism for secondary structure assessment, or functional reconstitution into liposomes or nanodiscs .

What considerations are important when designing experiments to study Tm4sf4 signaling pathways?

When investigating Tm4sf4 signaling pathways, researchers should consider several methodological aspects:

  • Cellular context:

    • Use cell types with physiological relevance (hepatocytes, intestinal epithelial cells)

    • Consider establishing stable cell lines with controlled Tm4sf4 expression

    • Account for endogenous expression levels when interpreting results

  • Temporal dynamics:

    • Include appropriate time points for acute versus chronic responses

    • Consider using inducible expression systems for temporal control

    • Employ live-cell imaging with fluorescent reporters for real-time analysis

  • Pathway specificity:

    • Use pathway-specific inhibitors as controls

    • Implement genetic approaches (dominant-negative constructs, CRISPR knockouts)

    • Validate key findings with multiple methodological approaches

  • Quantitative analysis:

    • Phospho-proteomics for comprehensive pathway analysis

    • Dose-response studies to establish mechanistic relationships

    • Mathematical modeling to integrate complex signaling networks

  • Physiological relevance:

    • Correlate in vitro findings with in vivo models

    • Consider 3D culture systems that better recapitulate tissue architecture

    • Validate under different conditions (stress, growth factors, matrix components)

How can researchers optimize detection methods for endogenous versus recombinant Tm4sf4 in experimental systems?

Distinguishing between endogenous and recombinant Tm4sf4 is crucial for accurate experimental interpretation. The following approaches can be optimized:

  • Antibody-based detection:

    • Use epitope tags (His, Myc, FLAG) on recombinant protein for specific detection

    • Develop antibodies targeting species-specific regions when working across species

    • Validate antibody specificity using knockout/knockdown controls

    • Consider using two antibodies targeting different epitopes for confirmation

  • Nucleic acid-based detection:

    • Design PCR primers that distinguish endogenous from recombinant transcripts

    • Use probe-based assays targeting unique junction regions in recombinant constructs

    • Implement RT-qPCR with standard curves for quantitative analysis

  • Protein characterization:

    • Use western blotting with mobility shift analysis (tagged proteins typically migrate differently)

    • Implement mass spectrometry for definitive identification

    • Consider 2D gel electrophoresis for detailed protein characterization

  • Localization studies:

    • Use fluorescent protein fusions for recombinant protein visualization

    • Implement proximity ligation assays for specific detection of protein complexes

    • Consider split-reporter systems for verification of protein-protein interactions

By implementing these methodological approaches, researchers can effectively distinguish between endogenous and recombinant Tm4sf4, enabling more accurate interpretation of experimental results.

What emerging technologies could advance our understanding of Tm4sf4 biology?

Several cutting-edge technologies hold promise for deepening our understanding of Tm4sf4 biology:

  • Single-cell technologies:

    • Single-cell RNA-seq to map expression patterns across cell populations

    • Single-cell proteomics for protein-level characterization

    • Spatial transcriptomics to correlate expression with tissue architecture

  • Advanced imaging techniques:

    • Super-resolution microscopy for visualizing membrane organization

    • Correlative light and electron microscopy for structural context

    • Live-cell imaging with optogenetic tools for temporal control

  • Structural biology approaches:

    • Cryo-electron microscopy for membrane protein structure determination

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

    • AlphaFold and other AI-based structure prediction models

  • Gene editing technologies:

    • CRISPR base editing for precise modification without double-strand breaks

    • CRISPR screens for systematic functional analysis

    • CRISPR activation/interference for regulated expression

  • Organoid and microfluidic technologies:

    • Patient-derived organoids for personalized studies

    • Organ-on-a-chip systems for physiological relevance

    • Microfluidic devices for precise manipulation of cellular microenvironments

How might comparative studies across TM4SF family members advance therapeutic targeting approaches?

Comparative studies across TM4SF family members could significantly enhance therapeutic targeting strategies by:

  • Identifying family-wide versus member-specific functions:

    • Systematic CRISPR knockout of individual members

    • Comparative interactome analysis across family members

    • Analysis of compensatory mechanisms following single-member depletion

  • Characterizing structural similarities and differences:

    • Comparative structural analysis to identify conserved binding pockets

    • Epitope mapping to develop member-specific antibodies

    • Identification of conserved post-translational modification sites

  • Developing pan-family versus selective targeting strategies:

    • Small molecule screens against multiple family members

    • Polypharmacology approaches targeting multiple members simultaneously

    • Structure-based drug design exploiting member-specific features

  • Evaluating synergistic effects:

    • Combinatorial targeting of multiple family members

    • Analysis of synthetic lethality relationships

    • Pathway-level effects of targeting multiple TM4SF proteins

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.