Recombinant Rat Transmembrane and coiled-coil domains protein 1 (Tmco1)

Shipped with Ice Packs
In Stock

Description

Chemical Properties and Structure

Tmco1 is a transmembrane protein featuring coiled-coil domains . It is located on chromosome 1q23.3 in humans . Tmco1 acts as an endoplasmic reticulum (ER) calcium-selective channel . This protein prevents the overfilling of intracellular calcium stores and maintains calcium homeostasis in the ER .

Role in Osteoporosis

Studies have found that decreased levels of Tmco1 are associated with osteoporosis in both human and mouse subjects . In osteoporotic individuals, Tmco1 expression is significantly lower compared to healthy controls . The absence of Tmco1 impairs osteoblast differentiation and bone formation .

Tmco1 knockout mice exhibit reduced bone mass and altered bone microarchitecture, which are characteristic of osteoporosis . These mice showed a significant decrease in trabecular bone volume, bone mineral density, and cortical thickness .

Mechanism of Action in Bone Formation

Tmco1 influences bone formation through the CaMKII-HDAC4-RUNX2 signaling axis . Specifically, Tmco1-mediated calcium leak activates this signaling pathway, which is vital for osteogenesis . When Tmco1 is deficient, it disrupts ER calcium homeostasis, leading to the degradation of RUNX2, a key transcription factor for osteoblast function .

Impact on Gene Expression

In Tmco1 knockout osteoblasts, the mRNA levels of osteogenic genes such as alkaline phosphatase (Alp), osteocalcin (Ocn), and collagen type I alpha 1 (Col1) are significantly downregulated compared to control osteoblasts . This downregulation impairs osteoblast differentiation and function, further contributing to bone loss .

Association with TMCO1 Defect Syndrome

Mutations in the TMCO1 gene are linked to craniofacial dysmorphism, skeletal anomalies, and mental retardation syndrome . A homozygous mutation in TMCO1 can lead to the skipping of exon 5 during cDNA sequencing, resulting in a premature termination codon .

Clinical Significance

  • Ovarian Cancer: Tmco1 regulates cell proliferation, metastasis, and EMT signaling through CALR, promoting ovarian cancer progression and cisplatin resistance .

  • Seizures: Mutations in Tmco1 have been associated with seizures in children .

  • Cerebrofaciothoracic Dysplasia: Tmco1 deficiency can cause autosomal recessive cerebrofaciothoracic dysplasia .

Data Tables

MeasurementWild-Type MiceTmco1 Knockout Mice
Trabecular Bone Volume (BV/TV)NormalSignificantly Decreased
Bone Mineral Density (BMD)NormalSignificantly Decreased
Trabecular Thickness (Tb.Th)NormalSignificantly Decreased
Cortical Thickness (C.Th)NormalSignificantly Decreased
Trabecular Spacing (Tb.Sp)NormalIncreased
Osteoblast Markers (Col1a1, Ocn)NormalReduced
Gene ExpressionControl OsteoblastsTmco1 Knockout Osteoblasts
AlpNormalSignificantly Downregulated
OcnNormalSignificantly Downregulated
Col1NormalSignificantly Downregulated

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
Tmco1; Calcium load-activated calcium channel; CLAC channel; Meg-2-like protein; Transmembrane and coiled-coil domain-containing protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Tmco1
Target Protein Sequence
MSTMFADTLLIVFISVCTALLAEGITWVLVYRTDKYKRLKAEVEKQSKKLEKKKETITES AGRQQKKKIERQEEKLKNNNRDLSMVRMKSMFAIGFCFTALMGMFNSIFDGRVVAKLPFT PLSYIQGLSHRNLLGDDTTDCSFIFLYILCTMSIRQNIQKILGLAPSRAATKQAGGFLGP PPPSGKFS
Uniprot No.

Target Background

Function

Transmembrane and coiled-coil domains protein 1 (TMCO1) is a calcium-selective channel crucial for preventing calcium store overload, thus playing a vital role in calcium homeostasis. In response to endoplasmic reticulum (ER) stress, TMCO1 assembles into a homotetramer, forming a functional calcium-selective channel that regulates ER calcium content. It is also a component of a ribosome-associated ER translocon complex involved in the transport of multi-pass membrane proteins into the ER membrane and their biogenesis. Specifically, TMCO1, along with SEC61 and TMEM147, forms a lipid-filled cavity within the translocon. TMEM147 may insert hydrophobic segments of multi-pass membrane proteins from the lumen into this central membrane cavity, a process regulated by SEC61. Similarly, TMCO1 may insert hydrophobic segments of nascent chains from the cytosol into the cavity.

Database Links
Protein Families
TMCO1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.