Recombinant Rat Transmembrane and ubiquitin-like domain-containing protein 1 (Tmub1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Tmub1; Hops; Transmembrane and ubiquitin-like domain-containing protein 1; Hepatocyte odd protein shuttling protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-245
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Tmub1
Target Protein Sequence
MALIEGVGDEVTVLFSVLACLLVLALAWVSTHTTESTDPLPQSSGTTTPAQPSEAMTAID SIREEAPGAESPSLRHRGPSAQPEPEAGVTASTPPDSPQEPLLLRLKFLNDSEQVARAWP QDTIGSLKRTQFPGREQQVRLIYQGQLLGDDTQTLGSLHLPPNCVLHCHVSTRVGPPHPP CPPGSEPGPSGLEIGSLLLPLLLLLLLLLWYCQIQYRPFFPLTATLGLAGFTLLLSLLAF AMYRP
Uniprot No.

Target Background

Function

Tmub1 is involved in several key cellular processes. It participates in sterol-regulated ubiquitination and degradation of HMG-CoA reductase (HMGCR). It also plays a role in the positive regulation of AMPA-selective glutamate receptor GRIA2 recycling to the cell surface. Furthermore, it functions as a negative regulator of hepatocyte growth during liver regeneration. Tmub1 may contribute to translational regulation during cell-cycle progression and cell proliferation, and potentially to centrosome assembly. Finally, it modulates the stabilization and nucleolar localization of the tumor suppressor CDKN2A, enhancing its association with NPM1.

Gene References Into Functions
  1. miR-27a/b regulates hepatocyte proliferation by controlling the posttranscriptional modification of Tmub1 during liver regeneration. PMID: 29777440
  2. The transcriptional profile and potential biological processes affected by Tmub1 expression in hepatocytes have been described. PMID: 29344642
  3. HOPS exhibits distinct, isoform-specific functions in the nucleolus, nucleus, and cytoplasm. PMID: 24240191
  4. Tmub1 negatively regulates IL-6-induced hepatocyte proliferation. PMID: 22426572
Database Links
Subcellular Location
Membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane. Recycling endosome. Cytoplasm. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Nucleus. Nucleus, nucleolus.; [iHOPS]: Cytoplasm. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Nucleus, nucleolus. Nucleus.

Q&A

What is Tmub1 and where is it primarily expressed?

Tmub1 (Transmembrane and ubiquitin-like domain containing protein 1) is a ubiquitously expressed shuttling protein that moves between the nucleus and cytoplasm, particularly in hepatocytes. It contains three transmembrane domains, a ubiquitin-like (UBL) domain, and a nuclear export signal (NLS) that are critical during hepatocyte proliferation. The protein plays significant roles in liver regeneration and functions as a bridging protein in cellular proliferation processes .

What are the structural domains of Tmub1?

Tmub1 contains three key structural components:

  • Three transmembrane domains

  • A ubiquitin-like (UBL) domain (amino acids 121-175)

  • A nuclear export signal (NES) at the amino terminus

This unique structure allows Tmub1 to shuttle between different cellular compartments and participate in protein-protein interactions critical for its biological functions .

How does Tmub1 influence the cell cycle in normal hepatocytes?

Tmub1 functions primarily as a cell cycle-associated protein that inhibits proliferation in normal hepatocytes. Research using flow cytometry, EdU, CCK-8, and western blotting experiments has demonstrated that:

  • Overexpression of Tmub1 increases the proportion of cells in G1 phase while decreasing the proportion in S phase

  • Knockdown of Tmub1 increases the proportion of cells in S phase while decreasing the proportion in G1 phase

This indicates that Tmub1 may regulate the G1/S phase transition, acting as a checkpoint control element in the cell cycle .

What interactions does Tmub1 have with cell cycle regulatory proteins?

Co-immunoprecipitation assays have revealed that Tmub1 interacts specifically with cyclin A2 throughout the cell cycle (G1, S, and M phases). Additional research indicates that overexpression of Tmub1 may postpone cyclin A2 and cyclin B1 degradation in the M phase. This interaction suggests that Tmub1 may regulate cell cycle progression by modulating the stability and function of key cyclins .

Table 1: Cell Cycle Phase Distribution in Tmub1-modified BRL-3A Cells

Cell GroupG0/G1 Phase (%)S Phase (%)G2/M Phase (%)
Tmub1+Significantly increased*Significantly decreased*No significant change
Tmub1-Significantly decreased*Significantly increased*No significant change
Normal ControlBaselineBaselineBaseline
*p<0.01 compared to normal control

How is Tmub1 expression altered in hepatocellular carcinoma (HCC)?

Tmub1 is significantly downregulated in HCC tissues and cell lines compared to adjacent normal tissues and normal hepatocyte cell lines. Immunohistochemistry and western blotting analyses have shown that:

  • Lower levels of Tmub1 are detected in HCC tissues compared to adjacent normal tissues

  • Tmub1 levels in HCC cell lines (Hep3B, MHCC-LM3, MHCC-97h, and Huh7) are significantly lower than in the normal hepatocyte cell line L02

This downregulation is associated with malignancy features and correlates with poor survival in HCC patients .

What is the prognostic significance of Tmub1 expression in cancer?

Tmub1 expression has significant prognostic value in multiple cancer types:

These findings suggest that Tmub1 expression levels could serve as a valuable prognostic biomarker in cancer patients .

What mechanisms underlie Tmub1's tumor-suppressive function in HCC?

Tmub1 exerts its tumor-suppressive function in HCC through multiple mechanisms:

  • Promotion of apoptosis:

    • Tmub1 forms a protein complex with p63, particularly with the ΔN isoforms (ΔNp63α, β, and γ)

    • It promotes the ubiquitination and degradation of ΔNp63 proteins, leading to increased apoptosis in HCC cells

  • Regulation of STAT1 signaling:

    • Tmub1 positively regulates STAT1 expression and suppresses CCND1 expression in HCC cells

    • This regulatory axis inhibits HCC cell proliferation

  • Cell cycle inhibition:

    • Tmub1 negatively regulates cell cycle progression in HCC cells, partially through interactions with cyclin proteins .

How does TMUB1 influence PD-L1 expression and immune checkpoint blockade?

TMUB1 has been identified as a modulator of PD-L1 post-translational modifications in tumor cells with potential implications for immunotherapy. Mechanistically:

  • TMUB1 competes with HUWE1 (an E3 ubiquitin ligase) to interact with PD-L1, inhibiting its polyubiquitination at K281 in the endoplasmic reticulum

  • TMUB1 enhances PD-L1 N-glycosylation and stability by recruiting STT3A

  • This promotes PD-L1 maturation and tumor immune evasion

TMUB1 protein levels correlate with PD-L1 expression in human tumor tissue, with high expression being associated with poor patient survival rates. Notably, a synthetic peptide engineered to compete with TMUB1 significantly promotes antitumor immunity and suppresses tumor growth in mice, suggesting TMUB1 as a promising immunotherapeutic target .

What is the relationship between Tmub1 and immune cell infiltration in cancer?

Research using single-sample Gene Set Enrichment Analysis (ssGSEA) has revealed that TMUB1 expression correlates with immune cell infiltration in colorectal cancer:

  • TMUB1 expression negatively correlates with the abundance of T helper cells, Tcm cells, macrophages, and Th2 cells

  • TMUB1 expression positively correlates with the abundance of several immune cell types, including CD56bright and CD56dim NK cells

This suggests that TMUB1 might influence the tumor microenvironment by modulating immune cell infiltration, potentially affecting responses to immunotherapy .

What are the recommended approaches for studying Tmub1 in cell culture models?

For investigating Tmub1 in cell culture systems, several validated approaches include:

  • Genetic manipulation:

    • Lentiviral vectors for stable overexpression or knockdown of Tmub1

    • Transient transfection with expression plasmids or siRNAs

  • Functional assays:

    • Proliferation assays: EdU incorporation, CCK-8, and cell counting

    • Cell cycle analysis: Flow cytometry after propidium iodide staining

    • Apoptosis assays: TUNEL staining, Annexin V/PI staining

    • Migration/invasion: Transwell assays

  • Protein interaction studies:

    • Co-immunoprecipitation for detecting protein-protein interactions

    • Western blotting for protein expression analysis

    • Cell cycle synchronization techniques (nocodazole, double thymidine block, serum starvation) .

How can researchers effectively analyze Tmub1's role in cell cycle regulation?

To analyze Tmub1's role in cell cycle regulation, researchers should employ:

  • Cell cycle synchronization methods:

    • M phase: 330 nM nocodazole treatment for 18 hours

    • G1 phase: Serum starvation

    • S phase: Double thymidine block

  • Flow cytometry for cell cycle distribution analysis:

    • Collect cells at defined timepoints after synchronization

    • Analyze the proportion of cells in G0/G1, S, and G2/M phases

  • Western blot analysis of cell cycle proteins:

    • Examine cyclins A2, B1, D1, and E1 expression

    • Track protein degradation through time-course experiments

  • Co-immunoprecipitation at different cell cycle phases:

    • Identify phase-specific protein interactions

    • Determine how Tmub1 affects cyclin stability and function .

How might Tmub1's ubiquitin-like domain contribute to its biological functions?

Tmub1's ubiquitin-like (UBL) domain (amino acids 121-175) likely plays a crucial role in mediating protein-protein interactions and potentially influencing protein degradation processes. Studies suggest that:

  • The UBL domain may enable Tmub1 to interact with the ubiquitin-proteasome system

  • Tmub1 has shown the ability to mediate ubiquitylation and degradation of HMG-CoA reductase HMGCR by bridging SPFH2 to membrane-bound ubiquitin ligase gp78

  • Conversely, Tmub1 appears to inhibit the degradation of cyclin A2 and B1 in certain contexts

This suggests that Tmub1 may exert different effects on protein stability depending on the specific target and cellular context. Further research using domain-specific mutants could elucidate how the UBL domain contributes to Tmub1's diverse functions .

What are the transcriptional changes induced by Tmub1 modulation?

Microarray analysis has identified significant transcriptional changes associated with Tmub1 modulation in rat hepatocytes:

  • Differential expression analysis between Tmub1-overexpressing, Tmub1-knockdown, and normal BRL-3A cells identified 836 differentially expressed genes

  • Of these, 127 were designated as node genes through STRING analysis

  • GO and KEGG pathway analysis revealed that the top regulated categories included:

    • Response to cellular process

    • Biological regulation

    • Regulation of biological process

    • Response to stimulus

    • Regulation of cellular process

The cell cycle pathway was identified as the most significantly affected pathway. Further analysis identified 17 key node genes (including AURKB, MCM5, INCENP, TTK, STAT1, CCNA2, RRM2, SIRT1, MCM3, CDCA5, FBXO5, and PLK4) that were validated by RT-qPCR .

What potential therapeutic strategies could target Tmub1 in cancer?

Based on current research, several therapeutic strategies targeting Tmub1 show promise:

  • For cancers with high Tmub1 expression (e.g., certain colorectal cancers):

    • Development of small molecule inhibitors or blocking antibodies against Tmub1

    • Synthetic peptides that disrupt Tmub1's interaction with PD-L1, potentially enhancing immunotherapy responses

    • Combination therapies with immune checkpoint inhibitors

  • For cancers with low Tmub1 expression (e.g., HCC):

    • Gene therapy approaches to restore Tmub1 expression

    • Drugs that mimic Tmub1's pro-apoptotic effects

    • Compounds that enhance ΔNp63 degradation, mimicking Tmub1's mechanism

A synthetic peptide engineered to compete with TMUB1 has already shown promise in promoting antitumor immunity and suppressing tumor growth in mouse models, suggesting this could be a viable therapeutic approach .

What are the current gaps in understanding Tmub1's biochemical mechanisms?

Despite significant progress, several aspects of Tmub1's biochemical functions remain unclear:

  • The precise mechanisms by which Tmub1 regulates protein ubiquitination and degradation

  • The full spectrum of Tmub1's protein interaction partners across different tissues and cellular contexts

  • The structural basis for Tmub1's interaction with various targets (cyclin A2, p63, PD-L1)

  • The regulatory mechanisms controlling Tmub1's own expression and subcellular localization

  • The potential role of post-translational modifications in modulating Tmub1 activity

Future studies employing structural biology approaches, proteomics, and genome-wide CRISPR screens could help address these knowledge gaps .

How might environmental factors and cellular stress influence Tmub1 function?

Gene-chemical interaction annotations suggest that Tmub1 expression can be modulated by various environmental factors and cellular stressors:

  • Chemical exposure: Tetrachlorodibenzodioxin, dinitrotoluene, bisphenol compounds, and arsenic affect Tmub1 expression or methylation

  • Toxins: Aflatoxin B1 increases Tmub1 expression

  • Chemical mixtures: Bisphenol A, bisphenol F, and bisphenol S in combination decrease Tmub1 mRNA expression

This suggests that Tmub1 may serve as a stress-responsive factor whose expression and function could be altered under various environmental conditions. Further research is needed to understand how these changes might impact cellular functions and disease processes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.