Recombinant Rat Transmembrane protein 106C (Tmem106c)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rat Transmembrane Protein 106C (Tmem106c)

Recombinant Rat Transmembrane Protein 106C, also known as Tmem106c, is a protein that has been engineered for research purposes. This protein is derived from the rat version of the transmembrane protein 106C, which is part of a larger family of transmembrane proteins involved in various cellular processes. The recombinant form of this protein allows researchers to study its functions and interactions in a controlled environment.

Molecular Mechanisms

  • Cell Cycle Regulation: TMEM106C is involved in cell cycle progression, promoting proliferation and metastasis in cancer cells .

  • Gene Interactions: TMEM106C interacts with genes like CENPM and DLC-1, influencing cancer cell behavior .

Therapeutic Potential

  • Targeting TMEM106C: Inhibiting TMEM106C could offer a novel therapeutic strategy for treating cancers, including overcoming resistance to certain drugs .

Recombinant Rat Tmem106c in Research

The recombinant rat Tmem106c is used in research settings to study its biological functions and potential applications. While specific studies on this recombinant protein are scarce, it is likely used to explore mechanisms similar to those observed in human TMEM106C, such as cell cycle regulation and cancer progression.

Data Tables

Given the limited specific data available for recombinant rat Tmem106c, we can refer to general findings related to TMEM106C in cancer research:

Cancer TypeTMEM106C ExpressionClinical Implication
HCCOverexpressedPoor prognosis
Other cancersOverexpressed in manyPromotes proliferation

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. To prioritize a specific tag, please inform us during your order placement.
Synonyms
Tmem106c; Transmembrane protein 106C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-260
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Tmem106c
Target Protein Sequence
MGSQHSSALTFCQRKKDDNPEDLLAERDQEEAIAQFPYVEFTGRNSITCHTCQGAGYIPE EQVNKLVALIPHSDQRLRPQRTKQYVLLSVLLCLLASGLVFFFLFPHSVLVDDNGIRVSN VTFNKQDSLVVLDVTATLKIRNSNFYPVAVTNLFSQVQYMKAVVGSYTAANVSLIPPRSE HLVNFTVKAEVGGPSSYVYFYCTLPAILVHNIVIFMRTSVQISYIGHTSQSTLEAQHNVD CGENSTAVQSLLLVPWGPHL
Uniprot No.

Target Background

Database Links

KEGG: rno:315286

UniGene: Rn.99883

Protein Families
TMEM106 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Membrane; Lipid-anchor.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.