Recombinant Rat Transmembrane Protein 11, Mitochondrial (Tmem11) is a protein expressed in the mitochondrial outer membrane. It plays a role in various cellular processes, including mitochondrial dynamics and mitophagy. Recent studies have highlighted its interaction with other proteins and its impact on cellular functions.
Tmem11 is a mitochondrial protein that associates with the mitochondrial contact site and cristae organizing system (MICOS) complex, although its interaction with MICOS is not as strong as other components of the complex . The protein's structure includes a transmembrane domain, which is crucial for its function in the mitochondrial outer membrane.
The amino acid sequence of Tmem11 is well-defined, starting with MAAWGRRRLGPGGGSSRERVSLSATDCYIVHEIYSGENAQDQFEYELEQALEAQYKYIVI and ending with ELYAV . This sequence is essential for understanding its structural and functional properties.
Recent research has shown that Tmem11 forms complexes with BNIP3 and BNIP3L, proteins involved in mitophagy . Depletion of Tmem11 increases BNIP3/BNIP3L-dependent mitophagy, indicating its role in regulating mitochondrial turnover under stress conditions .
Tmem11 has been found to inhibit cardiomyocyte proliferation and cardiac regeneration. Its deletion enhances cardiomyocyte proliferation and improves heart function after injury, while overexpression inhibits these processes .
Recombinant Rat Tmem11 is produced using in vitro expression systems, such as E. coli . The recombinant protein is available in various sizes, typically stored in Tris-based buffers with glycerol to maintain stability .
Recombinant Rat Tmem11 is available from several suppliers, including CUSABIO TECHNOLOGY LLC and GeneBioSystems . These suppliers offer the protein in various sizes, with specific storage and handling instructions.
KEGG: rno:303196
UniGene: Rn.12974
Based on commercial research products, recombinant rat TMEM11 is successfully expressed in both prokaryotic and eukaryotic systems:
E. coli expression system - Used for producing full-length rat TMEM11 (1-190aa) with His-tag modifications
HEK293 cells - Employed for producing recombinant rat TMEM11 that maintains proper protein folding and post-translational modifications
The choice between these systems depends on research requirements, with E. coli providing higher yields while HEK293 cells offer better functional properties.
TMEM11 is a critical regulator of mitochondrial network architecture. Depletion of TMEM11 through siRNA or CRISPRi techniques leads to dramatic alterations in mitochondrial morphology:
In control cells with normal TMEM11 expression, approximately 90% display tubular mitochondria filling the cytoplasm
Upon TMEM11 knockdown, up to 45% of cells exhibit spherical and enlarged mitochondria, described as a "balloon phenotype"
TMEM11-depleted cells consistently show more than half of their mitochondria becoming enlarged and/or bulbous compared to the narrow tubular mitochondria observed in control cells
These morphological changes are distinct from those seen with depletion of other mitochondrial dynamics proteins like DRP1 (causing elongated tubules with some spherical entities) or OPA1 (causing small, numerous spherical mitochondria) . This suggests TMEM11 has a unique role in maintaining proper mitochondrial architecture.
TMEM11 regulates cardiomyocyte proliferation through a complex molecular pathway:
TMEM11 directly interacts with METTL1 (methyltransferase-like protein 1)
This interaction enhances m7G methylation of Atf5 mRNA, thereby increasing ATF5 protein expression
Elevated ATF5 promotes the transcription of Inca1, an inhibitor of cyclin-dependent kinase interacting with cyclin A1
INCA1 suppresses cardiomyocyte proliferation through cell cycle regulation
Experimental evidence shows that TMEM11 deletion enhances cardiomyocyte proliferation and improves heart function after myocardial injury. Conversely, TMEM11 overexpression inhibits neonatal cardiomyocyte proliferation and regeneration in mouse hearts . This TMEM11-METTL1-ATF5-INCA1 axis represents a potential therapeutic target for promoting cardiac repair and regeneration.
TMEM11 acts as a negative regulator of receptor-mediated mitophagy:
It localizes to the outer mitochondrial membrane where it directly interacts with the mitophagy receptors BNIP3 and BNIP3L (NIX)
TMEM11 stably forms a complex with BNIP3/BNIP3L that inhibits their mitophagy-promoting function
Depletion of TMEM11 enhances both basal mitophagy levels and hypoxia-induced mitophagy
This effect is specific to mitophagy, as basal macroautophagy (non-selective autophagy) remains unaltered by TMEM11 depletion
Under hypoxic conditions or with hypoxia mimetics like CoCl2, TMEM11 depletion further enhances BNIP3-dependent mitophagy, suggesting that metabolic state changes critically impact the TMEM11-NIX engagement dynamics . This positions TMEM11 as a key player in the fine-tuning of mitochondrial quality control.
To effectively study TMEM11's relationship with the Mitochondrial Contact Site and Cristae Organizing System (MICOS), researchers should consider these methodological approaches:
Proteomic analysis - To identify protein-protein interactions within the MICOS/MIB complex
Co-immunoprecipitation - To confirm direct interactions between TMEM11 and MICOS components
CRISPRi - For specific gene depletion to study functional relationships
Blue native PAGE - To analyze the assembly of protein complexes
Super-resolution microscopy - To visualize TMEM11 localization relative to MICOS components
Investigating TMEM11's role in cardiac regeneration requires a multi-faceted approach:
Genetic manipulation models:
TMEM11 knockout mice to assess enhanced regenerative capacity
TMEM11 overexpression models to confirm inhibitory effects
Targeted manipulation of the TMEM11-METTL1-ATF5-INCA1 pathway
Myocardial injury models:
Myocardial infarction (MI) induction followed by assessment of cardiac function
Evaluation of heart function after injury using echocardiography
Histological analysis of cardiac tissue repair
Cell proliferation assays:
These approaches provide comprehensive evaluation of how TMEM11 impacts cardiac repair processes and offer insights into potential therapeutic interventions targeting the TMEM11 pathway for heart failure treatment.
For optimal stability and functionality of recombinant rat TMEM11:
TMEM11 lyophilized powder:
TMEM11 pre-coupled magnetic beads:
Repeated freezing and thawing is not recommended for either format. For working aliquots of protein preparations, storage at 4°C for up to one week is acceptable .
Given the emerging evidence of TMEM11's dual localization, these techniques can help differentiate its membrane-specific functions:
Submitochondrial fractionation with protease protection assays:
Domain-specific antibodies or tagged constructs:
Generate tools targeting specific regions of TMEM11
Track different portions of the protein in distinct mitochondrial compartments
Site-directed mutagenesis:
Functional assays with membrane-specific inhibitors:
Use compounds that selectively permeabilize specific mitochondrial membranes
Measure TMEM11-dependent functions under these conditions
These approaches help resolve the apparent contradiction between earlier studies localizing TMEM11 to the IMM and recent findings of its OMM localization and function .
When utilizing TMEM11 pre-coupled magnetic beads for investigating protein interactions:
Bead properties:
Experimental considerations:
Optimize buffer conditions to maintain protein-protein interactions
Include appropriate controls (non-specific protein-coupled beads)
Consider pre-clearing samples to reduce non-specific binding
Use gentle washing techniques to preserve weak interactions
Applications:
This pre-coupled format allows for convenient and fast capture of target molecules with high specificity and efficient magnetic separation for studying TMEM11's diverse interaction partners.
The TMEM11-BNIP3/BNIP3L interaction is highly sensitive to metabolic conditions:
Under basal conditions:
TMEM11 maintains a steady inhibitory effect on BNIP3/BNIP3L-mediated mitophagy
This ensures appropriate levels of mitochondrial turnover for normal cellular function
Under hypoxic conditions:
Metabolic stress conditions:
Future research should explore whether TMEM11 functions as a metabolic sensor, either through its association with MICOS/MIB within mitochondria or via its interaction with NIX at the peri-mitochondrial environment. Understanding this relationship would provide crucial insights into how cells adapt mitochondrial quality control to changing metabolic demands.
The TMEM11-regulated pathway presents a promising therapeutic target for cardiac regeneration:
Therapeutic potential:
TMEM11 inhibition could enhance endogenous cardiomyocyte proliferation
This approach might promote cardiac repair after myocardial injury
Targeting this pathway could overcome the limited regenerative capacity of the adult heart
Intervention strategies:
Translational considerations:
Temporal control of intervention to promote repair without disrupting normal cardiac function
Tissue-specific targeting to avoid systemic effects on mitochondrial dynamics
Balance between enhanced proliferation and maintaining cardiomyocyte maturity and function
Research suggests that transient modulation of this pathway after cardiac injury could provide a novel therapeutic strategy that harnesses endogenous regenerative mechanisms rather than relying on cell transplantation approaches .
A comprehensive model of TMEM11 function must account for its effects on both mitochondrial morphology and mitophagy:
Structural role:
Regulatory role:
Integrated model:
TMEM11 may serve as a bridge between mitochondrial structure and turnover decisions
Structural changes in mitochondria could influence TMEM11's distribution between IMM and OMM
This redistribution could modulate its interaction with mitophagy receptors
The process potentially creates a feedback loop where mitochondrial morphology changes trigger appropriate mitophagy responses
Understanding how these dual functions are coordinated may reveal fundamental principles about mitochondrial quality control mechanisms and provide insights into disorders characterized by mitochondrial dysfunction.