Recombinant Rat Transmembrane protein 120A (Tmem120a)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Tmem120a; Ion channel TACAN; Transmembrane protein 120A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-343
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Tmem120a
Target Protein Sequence
MQSPPPDPLGDCLRNWEDLQQDFQGIQETHRLYRVKLEELTKLQDNCTNSITRQKKRLQE LALVLKKCRPSLPSESLEAAQELESQIKERQGLFFDMEAYLPKKNGLYLSLVLGNVNVTL LSKQAKFAYKDEYEKFKLYLTIILIVISFTCRFLLNSRVTDAAFNFLLVWYYCTLTIRES ILINNGSRIKGWWVFHHYVSTFLSGVMLTWPDGLMYQKFRNQFLSFSMYQSFVQFLQYYY QSGCLYRLRALGERHTMDLTVEGFQSWMWRGLTFLLPFLFFGHFWQLFNALTLFNLARDP ECKEWQVLMCGLPFLLLFLGNFFTTLRVVHQKFHSQQHGSKKD
Uniprot No.

Target Background

Function

Function: This ion channel is involved in sensing mechanical pain. It contributes to mechanosensitive currents in nociceptors, enabling the detection of mechanical pain stimuli. It may also play a role in adipogenesis.

Database Links
Protein Families
TMEM120 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Nucleus inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of recombinant rat Tmem120a protein?

Recombinant rat Tmem120a is a 343 amino acid transmembrane protein (full length) with the following amino acid sequence: MQSPPPDPLGDCLRNWEDLQQDFQGIQETHRLYRVKLEELTKLQDNCTNSITRQKKRLQELALVLKKCRPSLPSESLEAAQELESQIKERQGLFFDMEAYLPKKNGLYLSLVLGNVNVTLLSKQAKFAYKDEYEKFKLYLTIILIVISFTCRFLLNSRVTDAAFNFLLVWYYCTLTIRESILIKNGSRIKGWWVFHHYVSTFLSGVMLTWPDGLMYQKFRNQFLSFSMYQSFVQFLQYYYQSGCLYRLRALGERHTMDLTVEGFQSWMWRGLTFLLPFLFFGHFWQLFNALTLFNLARDPECKEWQVLMCGLPFLLLFLGNFFTTLRVVHQKFHSQQHGSKKD. When expressed in E. coli systems, it is typically tagged with His for purification purposes and has a molecular weight of approximately 36 kDa .

What are the optimal storage conditions for recombinant Tmem120a protein?

Optimal storage requires aliquoting the protein and maintaining it at -20°C to -80°C to preserve activity. Repeated freeze-thaw cycles significantly diminish protein quality and should be avoided. For working aliquots, 4°C storage is acceptable for up to one week. The recommended storage buffer is Tris/PBS-based with 6% trehalose at pH 8.0. For reconstitution, deionized sterile water should be used to reach a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol (final concentration) before aliquoting for long-term storage .

What is known about Tmem120a protein localization in cells?

The subcellular localization of Tmem120a remains controversial among researchers. Several distinct localizations have been reported:

  • Nuclear envelope and endoplasmic reticulum (ER)

  • Exclusively in the ER

  • Plasma membrane

These divergent findings may reflect cell-type specific differences or methodological variations. In adipocytes, nuclear envelope localization appears well-established, where Tmem120a influences the positioning of genetic material within the nucleus through interactions with lamins . This localization is particularly relevant to its role in adipocyte differentiation and metabolism.

What expression systems are recommended for producing recombinant rat Tmem120a?

E. coli expression systems have been successfully used to produce recombinant rat Tmem120a protein with high purity (>90% as determined by SDS-PAGE). For optimal results, the protein should be expressed with an N-terminal His-tag to facilitate purification using Ni-NTA affinity chromatography. Following expression and purification, the protein should be formulated as a lyophilized powder in a Tris-HCl buffer (pH 8.0). This approach yields functional protein suitable for biochemical and structural studies .

How can researchers effectively detect Tmem120a expression in tissue samples?

Multiple complementary approaches are recommended:

  • RNAscope fluorescent labeling: This technique provides high sensitivity detection of Tmem120a transcripts in tissue sections, particularly useful for co-localization studies with other markers like Piezo2. Studies have shown that >95% of Piezo2 positive DRG neurons also express Tmem120a .

  • Immunohistochemistry/Immunofluorescence: Using validated antibodies against Tmem120a, with appropriate controls including knockout tissues.

  • Western blotting: For quantitative assessment of protein levels.

  • Single-cell RNA sequencing: To characterize cell-type specific expression patterns, particularly valuable when correlating with functional properties like mechanosensitivity .

What are the recommended approaches for studying Tmem120a function in vivo?

The following methodological approaches have proven valuable:

  • Conditional knockout models: Tmem120a-cKO mice allow tissue-specific deletion, enabling researchers to distinguish between cell-autonomous and systemic effects. This approach has revealed adipocyte-specific roles in genome organization and lipid metabolism .

  • Fluorescent in situ hybridization (FISH): This technique has been instrumental in demonstrating altered positioning of genes relative to the nuclear envelope in Tmem120a knockout adipose tissues .

  • Behavioral assays for mechanosensation: Tmem120a mutant mice show reduced responses to mechanical stimuli, providing a functional readout for in vivo studies .

  • Electrophysiology in isolated neurons: Patch-clamp recordings from DRG neurons with Tmem120a knockdown show increased PIEZO2-mediated rapidly adapting current amplitudes, demonstrating a functional regulatory relationship .

How does Tmem120a regulate PIEZO2 channel function in mechanosensation?

Tmem120a functions as a negative regulator of PIEZO2, a key mechanosensitive channel. When TMEM120A and PIEZO2 are co-expressed, there is a significant reduction in mechanically activated (MA) currents compared to control cells. Mechanistically, siRNA knockdown of Tmem120a in isolated mouse DRG neurons increases PIEZO2-mediated rapidly adapting current amplitudes by approximately 50% compared to controls .

The regulatory relationship appears to involve direct or indirect interaction, with expression patterns showing an inverse correlation in functionally distinct neuronal populations:

  • Low threshold mechanoreceptors (tyrosine hydroxylase positive neurons) tend to express high Piezo2 and low Tmem120a levels

  • Nociceptors (Trpv1 positive neurons) typically express high Tmem120a and low Piezo2 levels

This expression pattern correlates with functional properties, as neurons with PIEZO2-mediated rapidly adapting currents have relatively high levels of Piezo2 and low levels of Tmem120a mRNA, while mechanically insensitive neurons show the opposite expression pattern.

What is the role of Tmem120a in genome organization and gene expression regulation?

Tmem120a plays a crucial role in maintaining proper genomic architecture within adipocytes. Studies of Tmem120a knockout mice have revealed:

  • Altered positioning of multiple genes, enhancers, and miRNA-encoding loci relative to the nuclear envelope in adipose tissue

  • Broad suppression of lipid metabolism pathway gene expression

  • Inappropriate activation of muscle-specific genes in adipose tissue

  • Disruption of miRNA-encoding loci positioning, affecting downstream gene regulation

The mechanism appears to involve Tmem120a's interaction with nuclear lamins, similar to other nuclear envelope proteins. This interaction helps position genetic material properly within the nucleus for appropriate gene expression patterns. When Tmem120a is absent, these positioning patterns are disrupted, leading to dysregulated gene expression profiles that contribute to the observed lipodystrophy phenotype .

What is the relationship between Tmem120a, CoA binding, and lipid metabolism?

Structural studies have revealed that TMEM120A forms a homodimer complex that can bind coenzyme-A (CoASH), suggesting a potential role in fatty acid synthesis and lipid modification. The protein contains α-helical barrels that bind CoA or cholesterol, with the binding space open on one side (presumed intracellular) and sealed on the other (presumed extracellular) .

  • Some studies support TMEM120A's function in regulating CoASH-dependent pathways involved in fatty acid synthesis

  • Other structural studies have questioned the presence of CoASH in human TMEM120A complexes and cast doubt on its direct role in lipid metabolism

How can researchers address the conflicting reports about Tmem120a's ion channel function?

TMEM120A was initially proposed to be a mechanically activated ion channel (also known as TACAN), but subsequent studies have challenged this function. To resolve these contradictions, researchers should:

  • Conduct comprehensive electrophysiological studies using multiple expression systems and recording configurations (whole-cell, cell-attached, excised patch)

  • Employ molecular dynamics (MD) simulations with membrane tension to predict potential ion-conducting pathways

  • Develop targeted mutations of key residues like M207 (which restricts the putative pore) to test channel function hypotheses

  • Investigate the influence of specific lipids on any observed channel activity, as TMEM120A's function may depend on lipid enrichment/depletion

Current evidence suggests that while TMEM120A alone may not facilitate MA currents in various cell lines, it consistently functions as a negative modulator of the PIEZO2 channel at the cell membrane. This regulatory function, rather than direct channel activity, may be its primary role in mechanosensation .

How should researchers interpret the contradictory findings regarding Tmem120a's subcellular localization?

To address the conflicting reports about Tmem120a localization (nuclear envelope, ER, or plasma membrane), researchers should:

  • Use multiple detection methods including immunofluorescence with different fixation protocols, subcellular fractionation, and proximity labeling approaches

  • Employ epitope-tagged versions with tags at different positions to rule out epitope masking effects

  • Include appropriate controls such as knockout tissues and overexpression systems

  • Consider cell type-specific differences as localization may vary between adipocytes, neurons, and heterologous expression systems

  • Investigate dynamic trafficking as Tmem120a might shuttle between compartments under different conditions

It's plausible that Tmem120a has multiple functional pools in different subcellular compartments, each contributing to its diverse reported functions.

What experimental approaches can help resolve the debate about Tmem120a's role in lipid metabolism?

The debate about Tmem120a's direct role in lipid metabolism versus indirect effects through gene regulation can be addressed through:

  • In vitro enzymatic assays to directly test if purified Tmem120a has lipid-modifying activity

  • Metabolic labeling studies in cells with Tmem120a knockdown/knockout to track fatty acid synthesis and elongation

  • Lipidomic profiling of tissues from wild-type and Tmem120a knockout animals to identify specific lipid species affected

  • Structure-function studies with mutations in the putative CoA binding site to determine if CoA binding is necessary for phenotypic effects

  • Time-course gene expression analysis during adipocyte differentiation to distinguish primary from secondary effects

These complementary approaches would help distinguish between direct enzymatic functions and indirect effects through altered gene expression.

What are promising therapeutic applications of Tmem120a research?

Several potential therapeutic applications emerge from current Tmem120a research:

  • Lipodystrophy treatments: Understanding how Tmem120a regulates adipose tissue development and maintenance could lead to therapies for lipodystrophy syndromes, including FPLD2 .

  • Pain management: Given Tmem120a's role as a negative regulator of PIEZO2-mediated mechanosensation, it represents a potential target for novel pain therapies, particularly for mechanical hypersensitivity conditions .

  • Metabolic disorders: The involvement of Tmem120a in lipid metabolism pathways suggests potential applications in treating metabolic disorders like obesity and diabetes .

  • Antiviral strategies: TMEM120A's interaction with STING and its role in the innate immune response against Zika virus suggests potential applications in antiviral therapy development .

What advanced techniques could enhance our understanding of Tmem120a functions?

Several cutting-edge approaches show promise for advancing Tmem120a research:

  • Cryo-electron microscopy: Further structural studies of Tmem120a in different conformational states and with various binding partners could clarify its molecular mechanisms.

  • Hi-C and chromosome conformation capture techniques: These methods could provide higher-resolution insights into how Tmem120a influences 3D genome organization in adipocytes and other tissues.

  • Single-molecule imaging in living cells: Tracking Tmem120a dynamics and interactions in real-time could resolve questions about its trafficking and function.

  • CRISPR-based screening: Systematic identification of genetic interactors could reveal new pathways and functions for Tmem120a.

  • Tissue-specific proteomics: Comprehensive identification of Tmem120a binding partners in different tissues could explain its diverse reported functions .

What is the relationship between Tmem120a and disease states beyond lipodystrophy?

Emerging evidence suggests Tmem120a may play roles in multiple disease contexts:

  • Mechanical pain disorders: Tmem120a mutant mice show reduced behavioral responses to mechanical stimuli, suggesting involvement in pain perception pathways .

  • Polycystic kidney disease: TMEM120A negatively regulates PKD2 channels through direct physical interaction, and Pkd2 knockdown combined with Tmem120a overexpression in zebrafish leads to cyst generation and tail curling, indicating potential relevance to autosomal dominant polycystic kidney disease (ADPKD) .

  • Viral infections: TMEM120A promotes protective gene expression changes during innate immune responses against Zika virus infection by interacting with STING and facilitating its translocation to the ER-Golgi intermediate complex .

  • Muscle-related disorders: Given Tmem120a's role in suppressing muscle gene expression in adipocytes, its dysregulation might contribute to disorders involving inappropriate muscle gene activation .

Further research into these potential disease associations could reveal new therapeutic targets and diagnostic approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.