Recombinant Rat Transmembrane protein 14C (Tmem14c)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested. Please contact us in advance; additional fees apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Tmem14c; Cdtw1; Transmembrane protein 14C; p11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-115
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Tmem14c
Target Protein Sequence
QKDSGPLVPLHYYGFGYAALVATGGIIGYAKAGSVPSLAAGLFFGGLAGLGAYQLSQDPR NVWVFLATSGTLAGIMGMRFYNSGKFMPAGLIAGASLLMVAPGVAKIQEITTMP
Uniprot No.

Target Background

Function
Essential for normal heme biosynthesis.
Database Links
Protein Families
TMEM14 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is Transmembrane Protein 14C and what is its primary function in cellular metabolism?

Transmembrane Protein 14C (Tmem14c) is a mitochondrial inner-membrane protein that plays an essential role in heme biosynthesis. It is enriched in vertebrate hematopoietic tissues and is required for terminal erythropoiesis. Functionally, Tmem14c facilitates the synthesis of mitochondrial protoporphyrin IX from coproporphyrinogen III, which is a critical step in the heme synthesis pathway .

Research has demonstrated that Tmem14c primarily functions in the terminal steps of the heme synthesis pathway, specifically facilitating the import of protoporphyrinogen IX into the mitochondrial matrix where it can be converted to protoporphyrin IX and subsequently used for heme production . This function is particularly crucial in developing erythroid cells where large amounts of heme are needed for hemoglobin production.

How is Tmem14c gene expression regulated during erythroid differentiation?

Tmem14c expression is upregulated during erythroid terminal differentiation. Gene expression profiling in terminally differentiating murine fetal liver-derived erythroid cells has identified Tmem14c as one of the genes that are significantly upregulated during this process .

The regulation appears to involve transcriptional mechanisms coordinated with other genes involved in heme synthesis. Studies have shown that Tmem14c gene expression is coregulated with genes essential for the transport of heme synthesis intermediates . This coordinated regulation ensures that all components necessary for efficient heme production are present during the critical stages of erythroid maturation when hemoglobin synthesis is at its peak.

Experimental data from differentiating murine embryonic stem cell-derived erythroid cells shows a significant increase in Tmem14c mRNA levels that correlates with increased heme synthesis, suggesting that transcriptional regulation of this gene is tightly linked to erythroid differentiation programs .

What are the established methods for studying Tmem14c function in heme biosynthesis?

Several complementary approaches have been developed to study Tmem14c function:

Genetic Manipulation Models:

  • Gene-trap mouse embryos (Tmem14c^(gt/gt)): These embryos develop severe anemia and typically die by embryonic day 13.5 (E13.5) .

  • CRISPR/Cas-mediated genomic editing: Used to generate stable compound heterozygote knockout cells .

  • shRNA silencing: Used to create stable Tmem14c knockdown cell lines .

Functional Assays:

  • Heme synthesis quantification: Measured through o-dianisidine staining for hemoglobinized cells and 55Fe-Tf metabolic labeling to determine heme synthesis rates .

  • Porphyrin analysis: Measurement of porphyrin intermediates to determine where the heme synthesis pathway is blocked in Tmem14c-deficient cells .

  • Rescue experiments: Using protoporphyrin IX analogs to ameliorate the heme synthesis defect in Tmem14c-deficient cells .

Localization Studies:

  • Confocal microscopy with mitochondrial markers (such as HSP60) to determine subcellular localization, yielding Mander's overlap coefficient >0.7 and Pearson's overlap coefficient of 0.67 .

  • Submitochondrial fractionation using hypotonic swelling to create mitoplasts, allowing for determination of inner versus outer membrane localization .

What are the recommended protocols for generating recombinant Rat Tmem14c for in vitro studies?

Based on established recombinant protein methodologies and the specific requirements for transmembrane proteins:

  • Gene Cloning and Vector Construction:

    • Clone the rat Tmem14c coding sequence (corresponding to amino acids similar to the human sequence from GenBank) into an expression vector with an N-terminal 6-His tag for purification .

    • Use codon optimization for bacterial expression if producing in E. coli systems.

  • Expression System Selection:

    • For functional studies of membrane proteins, mammalian expression systems (HEK293 or CHO cells) often provide better folding and post-translational modifications.

    • Alternatively, insect cell systems (Sf9 or Hi5) can be used for higher yields while maintaining eukaryotic processing.

  • Purification Strategy:

    • Solubilize membranes using mild detergents (CHAPS, DDM, or digitonin) to extract Tmem14c while preserving native conformation.

    • Purify using nickel affinity chromatography targeting the His-tag, followed by size exclusion chromatography for higher purity.

  • Quality Control:

    • Assess protein purity via SDS-PAGE (expected molecular weight approximately 24 kDa under non-reducing conditions) .

    • Verify identity by Western blotting with anti-Tmem14c antibodies.

    • Confirm proper folding through circular dichroism spectroscopy to ensure alpha-helical content expected for transmembrane proteins.

  • Storage Recommendations:

    • Lyophilize from a 0.2 μm filtered solution in appropriate buffer (similar to NaH₂PO₄, NaCl, and EDTA as used for other recombinant proteins) .

    • Store lyophilized product at -20°C to -80°C.

    • For reconstituted protein, avoid repeated freeze-thaw cycles and store at recommended temperatures (typically -80°C for aliquots).

How does Tmem14c deficiency impact embryonic development and what are the phenotypic consequences?

Tmem14c deficiency has profound developmental consequences, particularly in hematopoietic tissues:

Embryonic Lethality:

  • Tmem14c gene-trap mouse embryos (Tmem14c^(gt/gt)) develop severe anemia and most die by embryonic day 13.5 (E13.5) .

  • The primary cause of death is profound anemia due to defective erythropoiesis.

Hematopoietic Phenotypes:

  • Fetal liver erythroid cells from gene-trap embryos exhibit maturation arrest .

  • Tmem14c-deficient embryos show porphyrin accumulation in the fetal liver .

  • Analysis reveals a block in protoporphyrin IX synthesis in the mitochondria, while cytoplasmic porphyrin levels remain normal .

Cellular Mechanisms:

  • The biochemical defect manifests as decreased mitochondrial protoporphyrin IX synthesis .

  • The block occurs specifically at the import of protoporphyrinogen IX into the mitochondrial matrix .

  • This defect prevents completion of the heme synthesis pathway, resulting in accumulation of porphyrin precursors and insufficient hemoglobin production .

Tissue Specificity:

  • While Tmem14c is expressed in multiple tissues, the most severe phenotypes are observed in tissues with high heme requirements, particularly in developing erythroid cells .

  • This tissue-specific manifestation highlights the critical role of Tmem14c in cells that require high rates of heme synthesis.

What is the relationship between Tmem14c expression and various pathological conditions beyond anemia?

While Tmem14c was initially characterized for its role in erythropoiesis and heme metabolism, emerging research indicates broader implications in various pathological conditions:

Cancer Biology:

  • Recent studies have investigated Tmem14c as a potential biomarker in liver hepatocellular carcinoma (LIHC) .

  • Upregulated Tmem14c expression was associated with worse prognosis in LIHC patients based on clinicopathological characteristics .

  • Positive correlation was observed between Tmem14c expression and tumor-infiltrating immune cells (TIICs), suggesting potential roles in tumor immunology .

Pancreatic Cancer:

  • Analysis of transmembrane protein genes in pancreatic ductal adenocarcinoma (PDAC) revealed unique expression characteristics of TMEM genes, including Tmem14c .

  • This suggests potential involvement in cancer-specific cellular processes or possible value as diagnostic/prognostic markers.

Potential in Porphyria:

  • Given its role in porphyrin metabolism, researchers hypothesize that Tmem14c may function as a genetic modifier for the severity of porphyria in humans .

  • It has been predicted that further genetic sequencing studies might uncover Tmem14c hypomorphic mutations in individuals suffering from porphyrias of unknown etiology .

Chemical Interactions and Toxicology:

  • Numerous gene-chemical interaction annotations have been documented for rat Tmem14c, including responses to compounds like schisandrin B, 1,2-dimethylhydrazine, 17beta-estradiol, and tetrachlorodibenzodioxine .

  • These interactions suggest potential roles in toxicological responses and hormone-mediated pathways.

How can single-cell transcriptomic approaches advance our understanding of Tmem14c function in heterogeneous tissues?

Single-cell transcriptomic analysis represents a significant advancement for understanding Tmem14c function in complex tissue environments:

Cellular Heterogeneity Resolution:

  • Single-cell RNA sequencing can reveal cell type-specific expression patterns of Tmem14c that may be masked in bulk tissue analysis .

  • This approach has already been applied to assess differences in TMEM gene expression among various infiltrating cells in tumor microenvironments of pancreatic cancer .

Methodological Approach:

  • Sample Preparation and Quality Control:

    • Dissociate tissue into single-cell suspensions while minimizing stress responses

    • Perform rigorous quality control to retain viable cells (e.g., 53,123 cells were retained from 14 normal pancreatic tissues and 40 pancreatic tumor tissues in one study)

  • Analysis Workflow:

    • Integration of datasets and dimension reduction techniques (TSNE and UMAP)

    • Graph-based analysis to identify distinct cell clusters

    • Differential expression analysis to identify cell type-specific patterns

  • Functional Interpretation:

    • Cross-reference Tmem14c expression with known cell type markers

    • Perform trajectory analysis to map expression changes during cell differentiation

    • Correlate with functional heme synthesis markers in relevant cell types

Research Applications:

  • Mapping Tmem14c expression throughout erythroid differentiation at unprecedented resolution

  • Identifying novel cell types that rely on Tmem14c function beyond erythroid cells

  • Discovering potential compensatory mechanisms in Tmem14c-deficient cells

Challenges and Solutions:

  • Technical challenges including dropout events and batch effects can be addressed through computational approaches such as imputation algorithms and batch correction methods

  • Validation of findings requires orthogonal approaches such as spatial transcriptomics or immunofluorescence to confirm expression patterns

What are the current models explaining the molecular mechanism of Tmem14c-facilitated protoporphyrinogen IX transport?

Current models of Tmem14c function in protoporphyrinogen IX transport are still evolving, with several mechanistic hypotheses under investigation:

Direct Transport Model:

  • Tmem14c may function directly as a protoporphyrinogen IX transporter, facilitating its movement across the inner mitochondrial membrane .

  • This model is supported by the mitochondrial inner membrane localization of Tmem14c and the specific accumulation of porphyrin precursors observed in Tmem14c-deficient cells .

Adaptor/Complex Formation Model:

  • Alternatively, Tmem14c might function as a molecular adaptor that facilitates the interaction of proteins involved in porphyrin transport .

  • Its relative proximity to heme synthetic enzymes coproporphyrinogen oxidase and protoporphyrinogen oxidase suggests it could form part of a larger metabolic complex .

Structural Considerations:

  • As a transmembrane protein, Tmem14c likely contains multiple membrane-spanning domains that could form a channel or recognition site for porphyrin intermediates.

  • The specific structural features that determine substrate specificity remain to be fully elucidated.

Experimental Evidence:

  • The heme synthesis defect in Tmem14c-deficient cells can be ameliorated with a protoporphyrin IX analog, indicating that Tmem14c primarily functions in the terminal steps of the heme synthesis pathway .

  • This finding supports the model where Tmem14c facilitates the movement of protoporphyrinogen IX specifically, rather than affecting earlier steps in the pathway.

Outstanding Questions:

  • The precise biophysical mechanism of substrate recognition and transport

  • Whether Tmem14c functions as a monomer or as part of a larger complex

  • The regulatory mechanisms that modulate its transport activity during periods of high heme demand

  • The potential interactions with other mitochondrial proteins involved in heme metabolism

What approaches might be most effective for developing Tmem14c-targeted therapeutics for congenital anemias and porphyrias?

Developing Tmem14c-targeted therapeutics presents both challenges and opportunities, with several promising approaches:

Gene Therapy Approaches:

  • Viral Vector Delivery:

    • AAV vectors could be engineered to deliver functional Tmem14c to erythroid precursors

    • Lentiviral vectors with erythroid-specific promoters might achieve long-term expression in hematopoietic stem cells

  • Gene Editing:

    • CRISPR/Cas9 technology could be employed to correct Tmem14c mutations

    • Base editing or prime editing might offer more precise correction with fewer off-target effects

Small Molecule Development:

  • Screening Strategy:

    • High-throughput screens using cells with reporter systems linked to heme production

    • Structure-based virtual screening if crystal structures become available

  • Therapeutic Mechanisms:

    • Compounds that enhance residual Tmem14c activity in hypomorphic mutations

    • Molecules that stabilize partially functional Tmem14c protein

    • Alternative pathway activators that bypass the need for Tmem14c

Bypassing Strategies:

  • Protoporphyrin IX Analogs:

    • Research has shown that protoporphyrin IX analogs can ameliorate the heme synthesis defect in Tmem14c-deficient cells

    • Development of cell-permeable, bioavailable analogs could provide symptomatic relief

  • Alternative Transport Pathway Activation:

    • Identifying and upregulating redundant or compensatory transport mechanisms

    • Engineering synthetic transporters that can perform Tmem14c's function

Challenges and Considerations:

  • Targeting therapeutics specifically to erythroid precursors

  • Achieving sufficient mitochondrial localization for small molecules

  • Potential toxicity of porphyrin analogs (photosensitivity issues)

  • Balancing efficacy with safety in a pathway central to cellular metabolism

Biomarker Development:

  • Liquid biopsy approaches to monitor porphyrin intermediate levels

  • Development of assays to measure functional transport activity in patient samples

The identification of Tmem14c as a protoporphyrinogen IX importer provides a genetic tool for further exploring erythropoiesis and congenital anemias, potentially leading to novel therapeutic approaches for these conditions .

What are the common technical challenges in studying Tmem14c and how can they be addressed?

Researchers face several technical challenges when studying Tmem14c, each requiring specific methodological solutions:

Protein Expression and Purification:

ChallengeSolution ApproachTechnical Details
Low expression levelsCodon optimizationModify coding sequence to use preferred codons of expression system
Protein misfoldingFusion tagsN-terminal MBP or SUMO tags to enhance solubility
Aggregation during purificationDetergent screeningSystematic testing of different detergents (DDM, CHAPS, digitonin) for optimal extraction
Maintaining native conformationNanodiscs or liposomesReconstitute purified protein into membrane mimetics for functional studies

Functional Assays:

ChallengeSolution ApproachTechnical Details
Background heme synthesisSynchronized differentiationUse defined induction protocols with DMSO for MEL cells with consistent timing
Quantifying porphyrin intermediatesHPLC analysisSeparate and quantify specific porphyrin species with fluorescence detection
Low signal-to-noise ratioMetabolic labelingUse 55Fe labeling to track newly synthesized heme specifically
Distinguishing direct vs. indirect effectsRescue experimentsComplementation with wild-type and mutant constructs to determine functional domains

Localization Studies:

ChallengeSolution ApproachTechnical Details
Antibody specificity issuesEpitope taggingGenerate FLAG- or HA-tagged constructs when specific antibodies are unavailable
Distinguishing submitochondrial localizationProtease protection assaysHypotonic swelling followed by protease treatment to determine membrane orientation
Artifacts from overexpressionEndogenous taggingCRISPR knock-in of tags at endogenous loci for physiological expression levels
Co-localization analysisSuper-resolution microscopyTechniques like STORM or PALM to resolve submitochondrial structures beyond diffraction limit

Gene Manipulation:

ChallengeSolution ApproachTechnical Details
Embryonic lethalityConditional knockoutFloxed alleles with tissue-specific Cre expression for temporal control
Incomplete knockdownMultiple shRNA constructsUse of at least three different target sequences for validation
Off-target effects in CRISPRGuide RNA designCareful design with minimal off-target prediction and validation by sequencing
Compensatory mechanism activationAcute depletion systemsDegron-based systems for rapid protein depletion to avoid compensation

How can contradictory findings in Tmem14c research be reconciled through experimental design?

Contradictory findings are common in emerging research fields and can arise from various sources. Here's a methodological framework for addressing contradictions in Tmem14c research:

Systematic Analysis of Conflicting Results:

  • Identify Specific Variables:

    • Cell/tissue types used (primary cells vs. cell lines; embryonic vs. adult tissues)

    • Genetic background differences between mouse/rat strains

    • Methodological differences in knockdown/knockout strategies

    • Assay conditions and timepoints examined

  • Replicate Experiments Under Standardized Conditions:

    • Use identical reagents, cell sources, and protocols across laboratories

    • Implement blinded analysis to minimize experimenter bias

    • Pre-register experimental designs before conducting reconciliation studies

Common Sources of Contradictions and Solutions:

Species and Isoform Differences:

  • While Tmem14c is conserved across species, functional differences may exist between human, mouse, and rat orthologs

  • Solution: Direct comparative studies using the same experimental platform with Tmem14c from different species

Cell Type Specificity:

  • Contradictions may arise from studying different cell types where Tmem14c may have context-dependent functions

  • Solution: Systematic characterization across a panel of cell types using consistent methodologies

Knockdown vs. Knockout Discrepancies:

  • shRNA approaches may have off-target effects or incomplete silencing

  • Complete knockout may activate compensatory mechanisms not seen with partial knockdown

  • Solution: Use complementary approaches (CRISPR knockout, shRNA knockdown, and dominant-negative approaches) in parallel studies

Temporal Considerations:

  • Developmental timing may influence Tmem14c function and requirement

  • Solution: Time-course experiments with conditional systems for precise temporal control

Example Reconciliation Approach:

For contradictory findings on whether Tmem14c affects mitochondrial iron homeostasis:

  • Standardized Measurement Protocol:

    • Measure 55Fe uptake in both basal and differentiating cells under identical conditions

    • Quantify both total cellular and mitochondria-specific iron pools

    • Evaluate multiple iron-related parameters simultaneously (iron uptake, storage, and utilization)

  • Multi-parameter Analysis:

    • Correlate iron parameters with heme synthesis rates

    • Examine expression of iron regulatory genes and proteins

    • Determine if discrepancies relate to specific aspects of iron metabolism

  • Rescue Experiments with Controlled Variables:

    • Test whether iron supplementation rescues phenotypes in different model systems

    • Use structure-function analysis with chimeric proteins to identify domains responsible for discrepant results

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.