Recombinant Rat Transmembrane protein 150A (Tmem150a)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Rat Tmem150a

Tmem150a encodes a six-transmembrane domain protein involved in phosphatidylinositol 4-phosphate (PI4P) synthesis and plasma membrane localization of phosphatidylinositol 4-kinase (PI4K) complexes . Recombinant versions are produced in mammalian expression systems (e.g., HEK293 cells) to preserve post-translational modifications and functional integrity .

PropertyDetails
SpeciesRattus norvegicus (Rat)
Gene ID245966 (Rat Genome Database)
UniProt IDQ9QZE9
Protein LengthFull-length or partial constructs (customizable)
Post-Translational ModificationsNone specified; typically includes native folding and glycosylation patterns .

Domain Architecture

  • Six transmembrane helices with cytoplasmic N- and C-termini .

  • Interacts with TTC7A/TTC7B and FAM126A to regulate PI4K complex localization .

Key Functional Roles

  • PI(4,5)P₂ Homeostasis: Modulates PI4K activity, influencing plasma membrane PI(4,5)P₂ levels critical for signaling and membrane trafficking .

  • TLR4 Signaling: Knockdown in epithelial cells increases LPS-induced cytokine secretion (e.g., IL6, CXCL8) .

  • Fasting-Induced Catabolism: Implicated in metabolic regulation under nutrient deprivation (inferred from orthologs) .

Quality Control

  • Endotoxin Levels: <1.0 EU/μg (LAL assay) .

  • Activity Assays: Validated via PI4K co-localization studies and PI(4,5)P₂ synthesis assays .

Cytokine Regulation

  • TMEM150A Knockdown: In H292 lung epithelial cells, siRNA-mediated silencing increased baseline and LPS-stimulated cytokine production (e.g., CCL5, IL6) by 2–3 fold, suggesting a regulatory role in inflammatory responses .

  • Mechanism: Likely via disrupted PI(4,5)P₂ metabolism, altering downstream signaling cascades .

PI4K Complex Dynamics

  • Interaction Partners: Binds EFR3B-palmitoylated isoforms to stabilize PI4KIIIα complexes in lipid-disordered membrane regions .

  • Functional Impact: Enhances PI(4,5)P₂ resynthesis rates by 40–60% after acute depletion .

Gene-Chemical Interactions

Key modulators of Tmem150a expression in rat models :

ChemicalEffect on ExpressionImplications
TetrachlorodibenzodioxinDecreasedEnvironmental toxin response
CisplatinIncreasedDNA damage response
MethamphetamineDecreasedNeurotoxicity studies
ClofibrateIncreasedLipid metabolism regulation

Available Reagents and Tools

  • Antibodies: Polyclonal anti-TMEM150A (HPA019015) validated for immunohistochemistry (1:50–1:200) and immunofluorescence .

  • Related Recombinant Proteins:

    • Mouse TMEM150A (MBS7099979)

    • Zebrafish TMEM150A (TMEM150A-4369Z)

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have any specific requirements for the format, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of the product is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Tmem150a; Tm6p1; Tmem150; Transmembrane protein 150A; Fasting-inducible integral membrane protein TM6P1; Transmembrane protein 150
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
25-271
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Tmem150a
Target Protein Sequence
MAVMNRHVCPVENWSYNDSCSPDPAEQGGPKTCCTLDDVPLISKCGTYPPESCLFSLIGN MGAFMVALICLLRYGQLLEQNRHSWINTTALITGCTNAAGLVVVGNFQVDHAKSLHYIGA GVAFPAGLLFVCLHCVLFYHGATTPLDMAMAYLRSVLAVIAFVTLVLSGVFFLHESSELQ HGAALCEWVFVLDILIFYGTFSYEFGAVSSDTLVAALQPAPGRACKSSGSSSTSTHLNCA PESIAMI
Uniprot No.

Target Background

Function
Tmem150a potentially plays a role in fasting-induced catabolism. It regulates the localization of phosphatidylinositol 4-kinase (PI4K) to the plasma membrane, potentially by reducing the association of TTC7 (TTC7A or TTC7B) with the PI4K complex. It acts as a regulator of phosphatidylinositol 4-phosphate (PtdIns(4)P) synthesis. Tmem150a may also be involved in fasting-induced catabolism.
Database Links
Protein Families
DRAM/TMEM150 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed with higher expression in placenta, liver and kidney.

Q&A

What is Transmembrane protein 150A (Tmem150a) and what is its basic structure?

Transmembrane protein 150A (Tmem150a) is a member of the TMEM150/damage-regulated autophagy modulator (DRAM) family of proteins. It possesses 6 transmembrane domains with both N-terminal and C-terminal ends positioned within the cytoplasm. The protein is encoded by the gene Tmem150a (also known as Tm6p1 or Tmem150) and has been identified in various species including rats (Rattus norvegicus), where it is cataloged under UniProt number Q9QZE9. The rat Tmem150a protein has an expression region spanning amino acids 25-271 and belongs to a family that includes other members such as DRAM1, DRAM2, TMEM150B, and TMEM150C. The full amino acid sequence reveals a complex transmembrane structure essential for its biological functions at cellular interfaces .

What are the known physiological functions of Tmem150a?

Tmem150a has been implicated in several important cellular processes. Research indicates that it positively regulates phosphoinositide production at the plasma membrane, suggesting a potential link to autophagosome formation and lysosomal fusion. Notably, Tmem150a transcript levels have been observed to increase in the liver under fasting conditions, which are known to induce autophagy. The protein appears to play a significant role in regulating immune responses, particularly through interaction with the TLR4 signaling pathway. Studies have demonstrated that cells lacking Tmem150a show enhanced cytokine production following TLR4 stimulation, suggesting that Tmem150a normally functions to moderate inflammatory responses. Additionally, Tmem150a appears to be essential for maintaining cytokine homeostasis in certain cell types even under non-stimulated conditions .

How does Tmem150a differ from other members of the TMEM150/DRAM family?

While all members of the TMEM150/DRAM family share structural similarities, including multiple transmembrane domains, they exhibit distinct functional characteristics. DRAM1 (also known as DRAM/FLJ11259) is a target gene of tumor suppressor p53 and has been implicated in regulating autophagy. Similarly, DRAM2 (TMEM77) and TMEM150B (DRAM3/TMEM224/TTN2) have established roles in autophagy regulation. Although TMEM150A has not been directly linked to autophagy in the same manner as other family members, its increased expression during fasting conditions and its role in phosphoinositide regulation suggest potential involvement in autophagy-related processes. Unlike other family members that have been more extensively characterized in autophagy pathways, Tmem150a appears to have a more distinctive role in cytokine regulation and TLR4-mediated immune responses, setting it apart functionally from its related proteins .

What are the recommended methods for effective knockdown of Tmem150a in experimental models?

For effective knockdown of Tmem150a in experimental cellular models, siRNA transfection has proven to be a reliable approach. Based on experimental protocols, researchers have successfully used specific siRNA sequences targeting Tmem150a, with some sequences showing greater knockdown efficiency than others. The methodology involves transfecting cells with approximately 5 pmol of Tmem150a-targeting siRNA using a transfection reagent such as Lipofectamine RNAiMax according to manufacturer's protocols. For adherent cell lines like HEK-TLR4, transfection is optimally performed after cells have adhered post-plating (approximately 18 hours), while for other cell types like H292 lung epithelial cells, concurrent transfection with plating has proven effective. Validation of knockdown efficiency should be conducted using RT-qPCR and/or Western blot analysis with anti-TMEM150A antibodies (such as NBP1-81885 from Novus Biologicals at 1:750 dilution). This approach typically yields significant reduction in Tmem150a expression, allowing for subsequent functional studies of the protein's role in cellular processes .

How should researchers verify the quality and activity of recombinant Tmem150a protein?

Verification of recombinant Tmem150a quality and activity requires multiple analytical approaches. First, protein purity should be assessed using SDS-PAGE to confirm the expected molecular weight (approximately 30-35 kDa) and assess band integrity. Western blot analysis using validated anti-Tmem150a antibodies can confirm identity. For functional verification, researchers should evaluate the protein's ability to regulate phosphoinositide production, particularly PI(4,5)P2, through in vitro kinase assays measuring phosphorylation of PI4P substrates. Alternatively, cell-based assays can measure changes in phosphoinositide levels following introduction of recombinant Tmem150a. Since Tmem150a has been shown to interact with phosphatidylinositol 4-kinase (PI4KIIIα), co-immunoprecipitation assays can confirm binding activity. When working with recombinant proteins, it's critical to use proper storage conditions (typically -20°C for short-term and -80°C for long-term storage), avoid repeated freeze-thaw cycles, and maintain working aliquots at 4°C for no more than one week to preserve activity. These quality control measures ensure that experimental outcomes accurately reflect Tmem150a's biological properties .

What cellular models are most appropriate for studying Tmem150a function?

The selection of appropriate cellular models for studying Tmem150a function depends on the specific aspects of the protein's biology being investigated. For examining Tmem150a's role in TLR4 signaling, modified HEK293 cells stably expressing TLR4 along with necessary cofactors MD2 and CD14 (HEK-TLR4) provide a well-defined system where TLR4 is the predominant toll-like receptor, allowing for specific pathway analysis. For investigating Tmem150a's broader role in cytokine regulation, human lung epithelial cell lines such as NCI-H292 (H292) are valuable models as they represent barrier-type epithelium that naturally responds to immune stimuli and produces multiple cytokines including CXCL8, CCL5, and IL6. These cells endogenously express cytokine transcripts for IL7, IL10, IL12B, IFN-γ, and TNF, making them suitable for comprehensive cytokine profiling studies. For studying Tmem150a's potential role in autophagy regulation, hepatic cell lines would be appropriate given the protein's increased expression in liver during fasting conditions. Primary rat cells may also provide physiologically relevant contexts for studying native Tmem150a function, particularly when investigating tissue-specific responses. Each model system offers distinct advantages depending on whether the research focus is on immune modulation, autophagy, or phosphoinositide regulation .

How does Tmem150a affect TLR4-mediated signaling pathways?

Tmem150a plays a significant regulatory role in TLR4-mediated signaling pathways, primarily functioning as a negative modulator of inflammatory responses. Research using HEK-TLR4 cells with TMEM150A knockdown has demonstrated that in the absence of Tmem150a, TLR4 activation by LPS leads to significantly increased production of CXCL8 (IL-8) at both protein and transcript levels. This effect is observed across multiple LPS concentrations (30-300 ng/mL), indicating that Tmem150a normally restrains TLR4-induced cytokine expression. The mechanism likely involves Tmem150a's known function in regulating phosphoinositide production, particularly PI(4,5)P2, which is a component of the TLR4 signaling pathway. PI(4,5)P2 serves as a precursor for second messengers such as diacylglycerol and inositol trisphosphate, which fluctuate during LPS stimulation. Through its interaction with phosphatidylinositol 4-kinase (PI4KIIIα), Tmem150a may modify the composition of the phosphatidylinositol 4-kinase enzyme complex, thereby influencing downstream signaling events following TLR4 activation. This regulatory function appears to be specific to TLR4 signaling, as control experiments with cells lacking TLR4 failed to produce CXCL8 after LPS exposure, confirming that the observed effects are dependent on the TLR4 pathway .

What cytokines are most affected by Tmem150a expression levels?

Experimental evidence indicates that Tmem150a expression levels significantly impact multiple cytokines, with the most pronounced effects observed in CXCL8, IL6, and CCL5 production. In HEK-TLR4 cells, knockdown of Tmem150a predominantly affects CXCL8 secretion, which is the primary cytokine produced by these cells following TLR4 stimulation. In human lung epithelial cells (H292), which have a broader cytokine expression profile, Tmem150a deficiency leads to significantly increased production of IL6 and CCL5 proteins following LPS stimulation, with CXCL8 showing a similar trend though with more variability. Beyond these three primary cytokines, multiplex analysis reveals that Tmem150a knockdown also enhances the production of IL7, IL10, IL12B, IFN-γ, and TNF. The wide range of affected cytokines suggests that Tmem150a functions as a general regulator of inflammatory responses rather than targeting specific cytokine pathways. Interestingly, in lung epithelial cells, Tmem150a appears to maintain cytokine homeostasis even under non-stimulated conditions, as its knockdown results in elevated cytokine levels even without TLR4 activation. This indicates that Tmem150a plays a crucial role in baseline immune regulation in addition to its function during active inflammatory responses .

What is the relationship between Tmem150a and phosphoinositide regulation?

Tmem150a has been established as a positive regulator of phosphoinositide production at the plasma membrane, particularly affecting the generation of phosphatidylinositol 4,5-bisphosphate [PI(4,5)P2]. This regulation occurs through Tmem150a's interaction with phosphatidylinositol 4-kinase (PI4KIIIα), which is responsible for the first step in PI(4,5)P2 synthesis. Specifically, Tmem150a appears to modify the composition of the phosphatidylinositol 4-kinase enzyme complex, thereby influencing the efficiency of PI4P production, which serves as the precursor for PI(4,5)P2. In the context of TLR4 signaling, levels of PI(4,5)P2 are enzymatically controlled and fluctuate in LPS-stimulated cells. PI(4,5)P2 is particularly important as it serves as a substrate for phospholipase C, generating the second messengers diacylglycerol and inositol trisphosphate, which are crucial for downstream signaling events. The regulatory effect of Tmem150a on phosphoinositide metabolism provides a mechanistic link to its role in autophagy, as phosphoinositides are essential for autophagosome formation and lysosomal fusion. This relationship may also explain the connection between Tmem150a and cytokine production, as altered phosphoinositide levels can affect multiple signaling pathways involved in immune responses. Thus, Tmem150a's function in phosphoinositide regulation represents a critical intersection point between membrane biology, immune signaling, and potentially autophagy regulation .

How might Tmem150a function differently across tissue types?

Tmem150a likely exhibits tissue-specific functions due to varying cellular environments and interaction partners. In liver tissue, Tmem150a expression increases during fasting conditions, suggesting a potential role in metabolic adaptation and possibly autophagy regulation in response to nutrient deprivation. This liver-specific response indicates that Tmem150a may be particularly important for hepatic functions related to energy homeostasis. In lung epithelial cells, Tmem150a appears to play a crucial role in maintaining cytokine homeostasis even under basal conditions, with its knockdown leading to increased cytokine production independent of TLR4 stimulation. This suggests that in barrier epithelia, which are continuously exposed to environmental stimuli, Tmem150a may function as a constitutive regulator of inflammatory responses to prevent excessive immune activation. In contrast, in other cell types like modified HEK cells, Tmem150a's effects on cytokine production are primarily observed following TLR4 activation, indicating a more stimulus-dependent role. Additionally, the interaction of Tmem150a with phosphatidylinositol 4-kinase and its effects on phosphoinositide production may vary across tissues depending on the specific phospholipid composition of different cell types and the expression levels of other regulatory proteins involved in phosphoinositide metabolism. Future research comparing Tmem150a function across primary cells from different tissues would significantly enhance our understanding of its context-dependent roles .

What are the implications of Tmem150a dysregulation for disease models?

The dysregulation of Tmem150a may have significant implications for various disease models, particularly those involving inflammatory processes and autophagy dysfunction. In inflammatory conditions, reduced Tmem150a expression or function could potentially lead to excessive cytokine production, as demonstrated by increased levels of CXCL8, IL6, CCL5, and other inflammatory mediators following Tmem150a knockdown. This suggests that Tmem150a deficiency might contribute to hyperinflammatory states observed in conditions such as sepsis, acute respiratory distress syndrome, or chronic inflammatory diseases. Given Tmem150a's role in regulating TLR4 signaling, its dysregulation may also influence the pathogenesis of conditions involving bacterial infections or endogenous danger signals that activate this pathway. From an autophagy perspective, alterations in Tmem150a expression could potentially affect autophagosome formation and lysosomal fusion through its impact on phosphoinositide production. Since autophagy dysregulation has been implicated in neurodegenerative disorders, cancer, and metabolic diseases, Tmem150a dysfunction might contribute to these pathologies. The protein's increased expression during fasting conditions further suggests potential involvement in metabolic disorders. Additionally, as a member of the DRAM family, which includes proteins with established roles in p53-mediated responses, Tmem150a dysregulation might influence cellular stress responses and potentially tumorigenesis. These diverse implications highlight the importance of investigating Tmem150a in various disease contexts to fully understand its pathophysiological relevance .

How does Tmem150a interact with other proteins in the autophagy pathway?

Although direct evidence for Tmem150a's interaction with specific autophagy proteins remains limited, several connections can be inferred based on its molecular functions and family relationships. As a regulator of phosphoinositide production, particularly PI(4,5)P2, Tmem150a may indirectly influence multiple proteins involved in autophagosome formation. Phosphoinositides are essential for the recruitment and activation of various autophagy-related proteins (ATGs) to pre-autophagosomal structures. Specifically, Tmem150a's interaction with phosphatidylinositol 4-kinase (PI4KIIIα) suggests it may affect the availability of PI4P, which serves as a precursor for PI(4,5)P2 and subsequently for PI(3,4,5)P3. These phosphoinositides are crucial for the activity of phosphoinositide 3-kinase (PI3K) complexes that generate PI3P, a key phospholipid in autophagosome biogenesis. Furthermore, as a member of the TMEM150/DRAM family, Tmem150a shares structural similarities with other family members like DRAM1, DRAM2, and TMEM150B, which have established roles in autophagy regulation. This suggests potential functional overlap or interaction with autophagy machinery. The increased expression of Tmem150a during fasting conditions, which are known to induce autophagy, further supports its potential involvement in this pathway. Future research employing techniques such as proximity labeling, co-immunoprecipitation followed by mass spectrometry, or yeast two-hybrid screening would be valuable in identifying specific autophagy proteins that directly interact with Tmem150a, potentially revealing new mechanistic insights into how this transmembrane protein influences autophagy processes .

What controls are essential when studying Tmem150a knockdown effects?

When studying Tmem150a knockdown effects, implementing a comprehensive set of controls is critical for ensuring experimental validity and accurate interpretation of results. Essential controls include: 1) Non-transfected wild-type cells to establish baseline expression and function; 2) Scrambled siRNA controls using non-targeting sequences with similar GC content to the Tmem150a siRNA to account for non-specific effects of the transfection procedure; 3) Multiple Tmem150a-targeting siRNA sequences to confirm that observed effects are specific to Tmem150a knockdown rather than off-target effects of a particular siRNA; 4) Knockdown validation controls using both RT-qPCR to quantify transcript reduction and Western blotting to confirm protein depletion, ideally showing at least 70-80% reduction in Tmem150a levels; 5) Time-course controls to determine the optimal time point for analyzing knockdown effects, as protein depletion may lag behind transcript reduction; 6) Dose-response controls when studying responses to stimuli like LPS, using multiple concentrations (e.g., 30-300 ng/mL) to establish whether Tmem150a's effects are consistent across stimulation intensities; 7) Cell viability assays to ensure that observed phenotypes are not due to cytotoxicity from the knockdown; and 8) Rescue experiments involving re-expression of siRNA-resistant Tmem150a to confirm that the observed phenotypes can be reversed. These controls collectively ensure that experimental outcomes can be confidently attributed to specific Tmem150a functions rather than experimental artifacts or off-target effects .

How should researchers analyze cytokine production in Tmem150a studies?

Analysis of cytokine production in Tmem150a studies requires a multi-faceted approach to capture both protein secretion and gene expression changes. For comprehensive analysis, researchers should implement the following methodology:

Table 1: Recommended Methods for Cytokine Analysis in Tmem150a Studies

Analysis LevelTechniqueApplicationControlsData Interpretation
Protein SecretionELISAQuantification of specific cytokines (CXCL8, IL6, CCL5)Standard curves, unstimulated cells, positive controls (LPS)Absolute concentration (pg/mL)
Multiple Cytokine DetectionMultiplex assay (e.g., Milliplex)Simultaneous detection of multiple cytokines (IL7, IL10, IL12B, IFN-γ, TNF)Internal standards, isotype controlsRelative fold changes compared to control
Transcript LevelRT-qPCRQuantification of cytokine mRNA levelsHousekeeping genes (GAPDH), no-RT controls2^-ΔΔCt calculation for fold change
Temporal DynamicsTime-course analysisDetermination of optimal sampling timesMultiple time points (0-48h)Kinetic profiles of cytokine production
Stimulus ResponseDose-response curvesSensitivity to activating signalsMultiple LPS concentrationsEC50 calculations

When analyzing data, researchers should first normalize cytokine measurements to appropriate controls (unstimulated cells, scrambled siRNA) and then perform statistical analysis using appropriate tests (typically ANOVA with post-hoc comparisons for multiple conditions). It's essential to examine both basal and stimulated cytokine production, as Tmem150a appears to affect both states in certain cell types. Additionally, correlation analysis between transcript and protein levels can provide insights into whether Tmem150a affects transcription, translation, or secretion processes. For comprehensive understanding, researchers should consider the broader cytokine network by examining ratios between pro-inflammatory and anti-inflammatory cytokines, which may reveal more subtle regulatory effects of Tmem150a on immune balance. Finally, validation in multiple cell types is crucial, as Tmem150a's effects on cytokine production appear to be context-dependent .

What are the key considerations for experimental design when investigating Tmem150a and TLR4 pathway interactions?

When investigating interactions between Tmem150a and the TLR4 pathway, experimental design must address several critical considerations:

Cellular Model Selection: Choose appropriate cell models that express functional TLR4 signaling components. HEK-TLR4 cells provide a clean system for pathway-specific analysis, while epithelial cells like H292 offer a more physiologically relevant context. Primary cells from different tissues should be considered to capture tissue-specific interactions.

Pathway Component Manipulation: Beyond Tmem150a knockdown, consider manipulating other TLR4 pathway components (MyD88, TRIF, TRAF6) to determine which arm of TLR4 signaling is most affected by Tmem150a. Use pathway inhibitors (e.g., TAK-242 for TLR4, U73122 for phospholipase C) to dissect specific signaling nodes.

Phosphoinositide Measurements: Incorporate direct measurements of phosphoinositide levels, particularly PI(4,5)P2, using techniques such as thin-layer chromatography, mass spectrometry, or fluorescent probes. Monitor changes in phosphoinositide composition following Tmem150a manipulation and TLR4 activation.

Temporal Dynamics: Implement time-course experiments to capture the kinetics of signaling events, as TLR4 activation involves both early MyD88-dependent and later TRIF-dependent responses. Sample multiple time points (15 minutes to 24 hours) following LPS stimulation.

Dose-Response Relationships: Utilize a range of LPS concentrations (1-1000 ng/mL) to determine if Tmem150a differentially affects responses at low versus high stimulation intensities, which might reveal threshold effects or saturation phenomena.

Interaction Partners: Perform co-immunoprecipitation or proximity labeling experiments to identify direct interaction partners of Tmem150a within the TLR4 signaling complex. Mass spectrometry analysis of these interactions can reveal novel components.

Downstream Signaling Analysis: Monitor activation (phosphorylation) of key signaling molecules including NF-κB, MAPKs (p38, JNK, ERK), and IRF3 to determine which downstream pathways are most affected by Tmem150a manipulation.

Biological Replicates and Power Analysis: Ensure sufficient biological replicates (minimum n=3) and perform power analysis to determine appropriate sample sizes, especially given the variability observed in some cytokine responses like CXCL8 in H292 cells.

By addressing these considerations in experimental design, researchers can obtain a comprehensive understanding of how Tmem150a modulates TLR4 signaling and develop mechanistic models of its regulatory function in inflammatory responses .

What emerging technologies could advance our understanding of Tmem150a function?

Several cutting-edge technologies hold promise for deepening our understanding of Tmem150a function. CRISPR-Cas9 genome editing offers advantages over siRNA by enabling complete knockout models and precise tagging of endogenous Tmem150a, allowing for visualization of its subcellular localization and dynamics. Single-cell RNA sequencing could reveal cell-to-cell variability in Tmem150a expression and its correlation with immune response heterogeneity. Advanced imaging techniques, including super-resolution microscopy and live-cell imaging with fluorescently tagged Tmem150a, would provide insights into its membrane organization and trafficking during cellular responses. For studying protein-protein interactions, proximity labeling methods (BioID, APEX) could identify the Tmem150a interactome in living cells, while hydrogen-deuterium exchange mass spectrometry could reveal structural changes upon activation. Phosphoproteomic analysis would help map how Tmem150a affects signaling cascade phosphorylation events. Organoid and tissue-specific models would enable investigation of Tmem150a in physiologically relevant systems. Particularly promising are recently developed sensors for phosphoinositides that could directly visualize how Tmem150a affects PI(4,5)P2 dynamics in real-time. Finally, systems biology approaches integrating multi-omics data could help position Tmem150a within broader regulatory networks governing immune responses and membrane dynamics .

How might Tmem150a research contribute to therapeutic developments?

Research into Tmem150a function holds significant potential for therapeutic developments across multiple disease areas. As a negative regulator of cytokine production, particularly following TLR4 activation, Tmem150a represents a promising target for inflammatory conditions characterized by excessive cytokine responses. Enhancing Tmem150a activity through small molecule modulators could potentially dampen hyperinflammatory states in sepsis, acute respiratory distress syndrome, or autoimmune disorders. Conversely, in conditions where immune responses need strengthening, such as in certain infections or immunodeficiencies, targeted inhibition of Tmem150a might enhance protective immunity. Given Tmem150a's role in regulating phosphoinositide production and its potential involvement in autophagy, therapeutic strategies targeting this protein might also influence neurodegenerative diseases where autophagy dysfunction is implicated. For example, enhancing Tmem150a function could potentially improve autophagic clearance of protein aggregates in conditions like Alzheimer's or Parkinson's disease. Additionally, the protein's increased expression during fasting conditions suggests potential applications in metabolic disorders. From a practical standpoint, the membrane localization of Tmem150a makes it an accessible target for therapeutic intervention, as transmembrane proteins are generally druggable with small molecules or antibodies. Development of high-throughput screening assays for Tmem150a modulators, coupled with detailed structural studies, could accelerate the identification of lead compounds. Furthermore, understanding tissue-specific functions of Tmem150a might enable the development of targeted therapies with reduced side effects by focusing on particular expression patterns or protein-protein interactions unique to specific tissues .

What are the potential applications of recombinant Tmem150a in experimental systems?

Recombinant Tmem150a offers versatile applications in experimental systems that extend beyond traditional protein studies. As a tool for functional reconstitution, purified recombinant Tmem150a can be incorporated into artificial membrane systems or liposomes to study its direct effects on membrane properties and phosphoinositide metabolism in a controlled environment. This approach could isolate Tmem150a's intrinsic functions from cellular complexity. In cell-based assays, recombinant Tmem150a with affinity tags enables identification of binding partners through pull-down experiments followed by mass spectrometry, potentially revealing novel interactions within signaling complexes. For structural biology, high-purity recombinant protein is essential for crystallography or cryo-electron microscopy studies that could elucidate the three-dimensional architecture of Tmem150a and provide insights into its membrane topology and functional domains. In immunological applications, recombinant Tmem150a can serve as an antigen for generating high-specificity antibodies needed for detection, localization, and functional studies. Additionally, recombinant protein with site-specific modifications or mutations allows for systematic structure-function analyses to identify critical residues or domains. The protein could also be employed in high-throughput screening assays to identify small molecules that modulate its activity, potentially leading to therapeutic development. Finally, labeled recombinant Tmem150a (fluorescent or radioactive) could track its cellular uptake, distribution, and metabolism, providing pharmacokinetic insights relevant to potential therapeutic applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.