Recombinant Rat Transmembrane protein 170B (Tmem170b)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Tmem170b; Ac1258; Transmembrane protein 170B; Liver regeneration-related protein LRRG102
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-132
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Tmem170b
Target Protein Sequence
MRAEGADHSMINLSVQQVLSLWAHGTVLRNLTEMWYWIFLWALFSSLFVHGAAGVLMFVM LQRHRQGRVLSIIAVSIGFLASVTGAMITSAAVAGIYRVAGKNMAPLEALVWGVGQTVLT LIISFSRILATL
Uniprot No.

Target Background

Database Links

KEGG: rno:361230

UniGene: Rn.62730

Protein Families
TMEM170 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of Rat TMEM170B?

Rat TMEM170B is a transmembrane protein that spans from one side of a biological membrane to the other, functioning as a gateway for specific substances across the membrane. Structurally, it is predicted to contain three transmembrane domains and is localized primarily to the plasma membrane . Like other transmembrane proteins, TMEM170B likely undergoes conformational changes in response to molecular interactions, facilitating transport across the membrane .

The protein is encoded by the Tmem170b gene (Gene ID: 361230) in Rattus norvegicus and has a UniProt ID of Q7TQ79 . While its exact physiological function is still being investigated, recent evidence suggests it plays a role as a tumor suppressor in several cancer models .

How can researchers effectively isolate and purify Rat TMEM170B?

Isolation and purification of TMEM170B present challenges common to transmembrane proteins. These proteins aggregate and precipitate in water, requiring specialized techniques for extraction . Methodologically, researchers should:

  • Use detergents or nonpolar solvents for extraction rather than aqueous solutions

  • Consider expressing recombinant TMEM170B with affinity tags (such as His-tag) to facilitate purification

  • Employ mammalian cell expression systems to ensure proper post-translational modifications

  • Maintain the protein in appropriate buffer conditions (PBS buffer is commonly used)

  • Consider protein stability during purification, as transmembrane proteins often require specific conditions to maintain their native conformation

For storage, purified recombinant TMEM170B can be maintained at +4°C for short-term storage, while long-term storage requires -20°C to -80°C temperatures to preserve functionality .

What detection methods are available for studying Rat TMEM170B expression?

Several methodological approaches can be employed to detect and quantify TMEM170B:

  • ELISA-based detection: Rat TMEM170B ELISA kits employ a sandwich ELISA technique with antibodies specific for TMEM170B pre-coated onto microplates. The assay quantifies TMEM170B through a color reaction proportional to the protein amount, using a biotin-conjugated antibody and Streptavidin-HRP system .

  • Western blotting: Using antibodies specific to TMEM170B or to tags on recombinant versions (such as His-tag) .

  • Immunohistochemistry/Immunocytochemistry: For tissue or cellular localization studies.

  • qRT-PCR: For quantifying TMEM170B mRNA expression levels.

  • Fluorescence microscopy: Using fluorescently-tagged antibodies or expressing fluorescently-tagged TMEM170B to visualize cellular localization.

Each method has distinct advantages depending on the research question being addressed.

What is the role of TMEM170B in cancer biology?

TMEM170B has emerged as a potential tumor suppressor based on several lines of evidence across different cancer types :

  • Breast cancer: TMEM170B appears to inhibit cell proliferation, suggesting tumor suppressive functions .

  • Pancreatic cancer: TMEM170B has been shown to influence:

    • Cellular invasion and migration capabilities

    • Immune cell infiltration into tumor microenvironments

The tumor suppressor function of TMEM170B contrasts with some other TMEM family proteins like TMEM45A and TMEM45B, which display oncogenic properties in various cancers . This differential function highlights the diverse roles of transmembrane proteins in cellular regulation and cancer progression.

Understanding the precise molecular mechanisms by which TMEM170B exerts its tumor suppressor function remains an active area of research, with potential implications for cancer therapeutics and diagnostics.

How does TMEM170B compare functionally to other TMEM family proteins?

TMEM family proteins exhibit diverse functions and cellular localizations, with TMEM170B showing distinct properties compared to other family members:

TMEM ProteinCellular LocalizationTransmembrane DomainsFunctionRole in CancerReference
TMEM170BPlasma membrane3Not fully characterizedTumor suppressor
TMEM45BER membrane, trans-Golgi, endosomes, lysosomes7Innate immunityOncogene
TMEM119Plasma membrane1Bone formation, osteoclast differentiationOncogene
TMEM106APlasma membrane1Macrophage activationTumor suppressor
TMEM158Plasma membrane2Neurotrophic peptide receptorDual role
TMEM88Plasma membrane, cytosolic2Wnt/β-catenin pathway regulationDual role

This comparative analysis reveals that TMEM proteins can function as either oncogenes or tumor suppressors depending on their specific molecular interactions and tissue context. TMEM170B's tumor suppressor function in breast and pancreatic cancers places it in a different functional category than oncogenic family members like TMEM45B .

What signaling pathways might be regulated by TMEM170B?

While the specific signaling pathways regulated by TMEM170B are not fully elucidated in the available literature, insights can be drawn from related TMEM proteins and their known interactions:

  • Cell cycle regulation: TMEM170B appears to influence cell proliferation in breast cancer models, suggesting potential interaction with cell cycle regulatory pathways .

  • Cell migration and invasion pathways: In pancreatic cancer, TMEM170B affects invasion and migration capabilities, potentially interacting with cytoskeletal reorganization pathways .

  • Immune signaling: TMEM170B influences immune cell infiltration in pancreatic cancer, suggesting potential roles in chemokine signaling or other immune-regulatory pathways .

By comparison, other TMEM family members interact with specific signaling networks:

  • TMEM45A interacts with TGF-β signaling in ovarian cancer

  • TMEM88 negatively regulates the Wnt/β-catenin pathway

  • TMEM158 has been associated with EMT pathways in multiple cancers

Research methodologies to identify TMEM170B-specific signaling interactions might include phosphoproteomic analysis after TMEM170B manipulation, co-immunoprecipitation studies, or transcriptomic analysis to identify downstream effectors.

What expression systems are optimal for producing functional recombinant Rat TMEM170B?

The choice of expression system significantly impacts the yield and functionality of recombinant TMEM170B:

For optimal experimental design, researchers should consider:

  • Including affinity tags (His-tag is commonly used) for purification

  • Validating proper membrane insertion and folding of the expressed protein

  • Confirming functionality through activity assays specific to the protein's known functions

What methods are effective for studying TMEM170B's role in cell proliferation and migration?

To investigate TMEM170B's reported functions in cell proliferation and migration, researchers can employ several methodological approaches:

  • Cell proliferation assays:

    • MTT/MTS/WST-1 colorimetric assays to measure metabolic activity

    • BrdU incorporation to measure DNA synthesis

    • Cell counting using automated systems

    • Colony formation assays for long-term proliferation effects

    • Cell cycle analysis by flow cytometry to determine which phase is affected

  • Migration and invasion assays:

    • Transwell migration assays (Boyden chamber)

    • Wound healing/scratch assays for directional migration

    • 3D invasion assays using extracellular matrix components

    • Time-lapse microscopy to track individual cell movements

  • Gene manipulation approaches:

    • CRISPR/Cas9 for TMEM170B knockout

    • siRNA/shRNA for transient or stable knockdown

    • Overexpression systems using tagged TMEM170B constructs

    • Inducible expression systems to study temporal effects

  • Downstream signaling analysis:

    • Western blotting to analyze activation of proliferation and migration-related signaling molecules

    • Phosphoproteomic analysis to identify regulated pathways

    • Transcriptomic profiling to identify gene expression changes

These methodologies should be designed to distinguish between direct and indirect effects of TMEM170B manipulation, ideally incorporating appropriate controls and time-course analyses.

How can TMEM170B's tumor suppressor functions be validated in animal models?

Validating TMEM170B's tumor suppressor function in vivo requires comprehensive animal model studies:

  • Xenograft models:

    • Implantation of TMEM170B-overexpressing cancer cells versus control cells in immunocompromised mice

    • Monitoring tumor growth rate, size, and metastatic potential

    • Analysis of tumor histology and molecular characteristics

  • Genetic mouse models:

    • Generation of conditional TMEM170B knockout mice

    • Crossing with cancer-prone genetic backgrounds (e.g., with mutations in oncogenes)

    • Monitoring spontaneous tumor development and progression

  • Orthotopic models:

    • Implantation of modified cancer cells directly into the organ of origin (e.g., pancreas for pancreatic cancer models)

    • Allows for assessment of tumor-microenvironment interactions specific to the tissue

  • Experimental metastasis assays:

    • Tail vein injection of TMEM170B-modified cancer cells

    • Monitoring lung colonization and metastatic spread

    • Analysis of circulating tumor cells

  • Therapeutic intervention studies:

    • Testing whether restoration of TMEM170B expression can suppress established tumors

    • Identifying small molecules that might mimic TMEM170B's tumor suppressive functions

These in vivo approaches should be complemented with comprehensive molecular analyses of tumor tissues, including immunohistochemistry, RNA sequencing, and proteomics to understand the mechanisms underlying TMEM170B's effects.

How can researchers differentiate between direct and indirect effects of TMEM170B in experimental systems?

Distinguishing direct from indirect effects of TMEM170B requires rigorous experimental design and data analysis:

  • Temporal analysis:

    • Implement time-course experiments after TMEM170B manipulation

    • Early changes (minutes to hours) are more likely to represent direct effects

    • Later changes (days) may indicate secondary or compensatory responses

  • Dose-response relationships:

    • Use inducible or titratable expression systems to correlate TMEM170B levels with observed phenotypes

    • Direct effects typically show proportional responses to protein levels

  • Protein interaction studies:

    • Employ co-immunoprecipitation or proximity labeling techniques (BioID, APEX) to identify direct binding partners

    • Yeast two-hybrid screening for potential interactors

    • Cross-linking mass spectrometry to capture transient interactions

  • Domain mapping and mutagenesis:

    • Create domain deletion or point mutation variants to identify functional regions

    • Correlate structural features with specific cellular functions

  • Pathway inhibitor studies:

    • Use specific inhibitors of suspected downstream pathways to determine if they can rescue TMEM170B-induced phenotypes

    • This helps establish causal relationships in signaling cascades

  • Single-cell analysis:

    • Employ single-cell transcriptomics or proteomics to identify cell-specific responses

    • Helps distinguish primary effects from those due to altered cellular composition

These approaches, when systematically applied, can help build a clearer picture of TMEM170B's direct functional impacts versus secondary consequences of its expression.

How should conflicting data regarding TMEM170B's role in different cancer types be reconciled?

Reconciling seemingly contradictory findings about TMEM170B across different cancer types requires several analytical approaches:

  • Tissue context consideration:

    • Different tissues have unique microenvironments and signaling networks

    • TMEM170B may interact with tissue-specific factors, resulting in context-dependent functions

    • Consider analyzing tissue-specific protein interaction networks

  • Methodological differences analysis:

    • Evaluate differences in experimental approaches (in vitro vs. in vivo)

    • Consider differences in protein detection methods (antibody specificity)

    • Assess whether full-length protein or specific isoforms were studied

  • Multi-omics integration:

    • Combine transcriptomic, proteomic, and functional data across cancer types

    • Look for common molecular signatures despite phenotypic differences

    • Identify cancer-specific co-expressed genes that might explain differential effects

  • Genetic background effects:

    • Consider the mutational landscape of different cancer models used

    • Analyze whether specific oncogenic drivers influence TMEM170B function

    • Check for genetic alterations affecting TMEM170B itself (mutations, copy number)

  • Quantitative threshold effects:

    • TMEM170B might exhibit biphasic effects depending on expression levels

    • What appears contradictory might reflect different points on a response curve

The dual role of some TMEM family members in cancer (both oncogenic and tumor suppressive) suggests that context-dependent functions are common in this protein family . Thorough documentation and reporting of experimental conditions and cellular contexts are essential for meaningful comparison across studies.

What bioinformatic approaches are valuable for predicting TMEM170B structure and function?

Given the challenges in experimentally determining membrane protein structures, bioinformatic approaches provide valuable insights into TMEM170B:

  • Transmembrane domain prediction:

    • TMHMM, HMMTOP, or Phobius algorithms can predict membrane-spanning regions

    • These analyses suggest TMEM170B contains 3 transmembrane domains

    • TopCons can provide consensus predictions from multiple algorithms

  • Protein structure prediction:

    • AlphaFold2 or RoseTTAFold can generate predicted 3D structures

    • For membrane proteins, specialized tools like MEMOIR may offer improved accuracy

    • Molecular dynamics simulations can refine models in membrane environments

  • Functional domain identification:

    • InterProScan can identify conserved domains and functional motifs

    • SMART or Pfam database searches reveal relationship to known protein families

    • Motif analyses for post-translational modification sites and trafficking signals

  • Evolutionary analysis:

    • Phylogenetic comparisons across species identify conserved regions

    • Evolutionary rate analysis highlights functionally constrained residues

    • Cross-species functional data can suggest conserved mechanisms

  • Network analysis:

    • Protein-protein interaction predictions (STRING, BioGRID)

    • Gene co-expression network analysis to identify functional associations

    • Pathway enrichment analysis to propose biological contexts

  • Integration with experimental data:

    • Mapping available experimental data onto predicted structures

    • Correlating structural features with known functional impacts of mutations

    • Guiding the design of targeted experimental approaches

These computational approaches should be viewed as hypothesis-generating tools that require experimental validation but can significantly accelerate functional characterization of poorly understood proteins like TMEM170B.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.