Recombinant Rat Transmembrane protein 176A (Tmem176a)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant Rat TMEM176A is synthesized using mammalian expression systems (e.g., HEK293 cells) or E. coli . Key production parameters include:

ParameterSpecification
Expression SystemMammalian cells (default) or E. coli
TagN-terminal His tag for affinity chromatography
Purity>80% (SDS-PAGE verified)
Endotoxin Levels<1.0 EU/μg (LAL assay)
StorageLyophilized or liquid form; -20°C to -80°C long-term; PBS buffer

Custom production options are available for specific experimental needs, with lead times of 5–9 weeks .

Research Applications

Recombinant Rat TMEM176A is utilized in:

  • Mechanistic Studies: Investigating its role in ion channel regulation, dendritic cell differentiation, and immune responses .

  • Disease Models: Linked to hepatocellular carcinoma (via HCA112 alias) and long QT syndrome .

  • Drug Interaction Screens: Used to assess transcriptional responses to toxins, pharmaceuticals, and environmental agents .

  • Protein Interaction Mapping: Identified interactors include HIVEP1, TGM2, and HRSP12, suggesting roles in transcriptional regulation and signal transduction .

Modulation of TMEM176A Expression

Studies using recombinant TMEM176A have revealed its sensitivity to diverse compounds:

CompoundEffect on TMEM176A ExpressionStudy ModelSource
ClofibrateDecreasedRat hepatocytes
AsbestosIncreasedMouse lung tissue
Cyclosporin ADecreasedHuman cell lines
RotenoneIncreasedRat neuronal cells

These findings highlight its regulatory role in toxicological and pharmacological responses .

Functional Insights

  • Immune Regulation: TMEM176A negatively regulates dendritic cell differentiation, impacting antigen presentation .

  • Environmental Stress Response: Upregulated by titanium dioxide and downregulated by perfluorinated compounds .

Challenges and Future Directions

While recombinant TMEM176A has advanced in vitro studies, challenges persist:

  • Functional Complexity: Its exact biochemical role (e.g., ion channel vs. signaling scaffold) remains unresolved .

  • Species-Specific Variants: Cross-reactivity differences between rat, human, and mouse homologs necessitate cautious interpretation .

Ongoing research aims to elucidate its therapeutic potential in autoimmune diseases and cancer .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we understand your specific needs. Please indicate any format preferences when placing your order, and we will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery details, kindly consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For convenience, we recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. To maintain protein integrity, avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
While we strive to meet your specific needs, please inform us if you have a preferred tag type. We will prioritize developing the specified tag whenever possible.
Synonyms
Tmem176a; Transmembrane protein 176A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-243
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Tmem176a
Target Protein Sequence
MSTDMGTADVGEVDPEAPQPTNIEVHIHQESVLAKLLLAGCSFLRVPASASTQSQGSSRV LVASWVVQIVLGILSVVLGGILYICHYLAMNTQGAPFWTGIVAMLAGAVAFLQKKRGGTC WALMRILLVLASFCTAVAAIVIGSREFNNYWYYLRDDVCKSDTSYRWSTMPSITPVPEEA NRIGLCKYYTSMLKTLLISLQAMLLGVWVLLLLASLIPVCVYLWKRFFTKAETEKKLLGA AVI
Uniprot No.

Target Background

Database Links

KEGG: rno:297077

UniGene: Rn.17071

Protein Families
TMEM176 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.