Recombinant Rat Transmembrane protein 176B (Tmem176b)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rat Transmembrane Protein 176B (Tmem176b)

Recombinant Rat Transmembrane Protein 176B (Tmem176b), also known as LR8 or TORID, is a synthetic version of the endogenous protein expressed in rodents. It belongs to the MS4A family of membrane proteins and is characterized by its role in modulating immune responses and cellular signaling pathways . This recombinant protein is engineered for research purposes, enabling studies on its structure, function, and therapeutic potential in disease models such as cancer and inflammation. Below is a detailed analysis of its production, structural features, and applications in scientific research.

3.1. Immune Modulation and Cancer Research

Tmem176b has been implicated in suppressing NLRP3 inflammasome activation by regulating cytosolic Ca²⁺ levels in myeloid cells . In cancer models, its inhibition enhances antitumor immunity by promoting interleukin-1β (IL-1β) secretion and CD8⁺ T-cell infiltration . For example:

  • Basal Cell Carcinoma: Rat Tmem176b is identified as a marker in basal cell carcinoma, suggesting its role in tumor progression .

  • RNA Interference (RNAi): Recombinant Tmem176b is used to design siRNA/shRNA constructs for gene silencing, aiding studies on its oncogenic potential .

Table 1: Applications of Recombinant Rat Tmem176b in Research

ApplicationMethodologyOutcomeSource
RNAi StudiessiRNA/shRNA knockdownReduced tumor growth in xenograft models
Western BlotAntibody detection (rabbit anti-Tmem176b)Validation of protein expression
Cancer BiologyInflammasome inhibition assaysSuppressed IL-1β secretion

Table 2: Comparative Analysis of Recombinant Tmem176b Production

SpeciesHost SystemTagPurityKey References
RatE. coliN/A≥85%
MouseE. coliHis-tag>90%
HumanE. coliHis-IF2DI>95%

Challenges and Future Directions

  • Production Limitations: Full-length recombinant Tmem176b remains challenging due to its transmembrane domains, necessitating partial constructs for functional studies .

  • Species-Specific Data Gaps: Most structural and functional data derive from mouse and human studies, requiring further validation in rat models .

  • Therapeutic Potential: Inhibitors of Tmem176b (e.g., BayK8644) show promise in enhancing immune checkpoint therapies, warranting further preclinical testing .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipment, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
Tmem176b; Lr8; Torid; Transmembrane protein 176B; Protein LR8; Tolerance-related and induced transcript protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-263
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Tmem176b
Target Protein Sequence
MAQATVTVDGVKVTSTRPQSAQISIHIHHKSALEQLLGAMGSLKKFLSYPQARIHYGQLS LGVTQILLGLVSCVLGVCLYFGPWTELCASGCAFWSGSVAILAGVGIVIHEMGQGKLSGH ISRLLLLACSATAAAATVMGVKSLIWQTSASYYFEISSTCDSLQPSIVDRFRSVRFTDDS DWRTERCREYLRMMMNLFLAFCILFTVICILKIVVSVASLGLSLRSMCGRNSQVLNDEET EKKLLGGDSAPASPTKEKIPVTP
Uniprot No.

Target Background

Function
Essential for the development of cerebellar granule cells. It may play a role in the maturation process of dendritic cells.
Gene References Into Functions
  1. TORID may be involved in the control of DC maturation and, consequently, may contribute to the induction or maintenance of allograft tolerance. PMID: 16095493
Database Links
Protein Families
TMEM176 family
Subcellular Location
Nucleus membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in spleen by a variety of myeloid cells including macrophages and dendritic cells (at protein level). Ubiquitously expressed with higher expression in lymphoid tissues.

Q&A

What is the molecular structure and basic function of Tmem176b?

Tmem176b is a transmembrane protein that functions primarily as an ion channel and regulator of inflammasome activation. Structurally, it contains multiple transmembrane domains that facilitate its integration into cellular membranes. Its primary function appears to be inhibition of the NLRP3 inflammasome, as disruption of Tmem176b enhances inflammasome activation as evidenced by increased neutrophil recruitment and IL-1β production in Tmem176b knockout models . This inhibitory function positions Tmem176b as a critical negative regulator of inflammatory responses, particularly in immune cells where inflammasome activity must be tightly controlled to prevent excessive inflammation.

How is Tmem176b expression regulated in normal and pathological tissues?

Tmem176b shows differential expression across tissues, with notable expression in immune cells, particularly dendritic cells and macrophages. In pathological conditions such as cancer, Tmem176b expression appears to be elevated. Research has demonstrated that Tmem176b is expressed in multiple cancer cell lines including MC38 (colon), LL/2 (lung), and EG7 (thymic lymphoma) . The regulation of its expression involves complex signaling networks that differ between normal physiology and disease states. In colorectal cancer, the Ala134Thr variant (rs2072443) in TMEM176B is associated with lower TMEM176B gene expression and increased NLRP3 inflammasome activity, suggesting genetic regulation of expression with potential implications for cancer susceptibility .

What are the most effective methods for studying Tmem176b function in vitro?

Effective in vitro methods for studying Tmem176b include:

  • RNA interference approaches: Using short hairpin RNA (shRNA) targeting Tmem176b to knockdown expression in cell culture models. Effective sequences for shRNA targeting Tmem176b include:

    • 5'-CTAGCTGGAGTTGGTACTATT-3'

    • 5'-TCTGGGTGTGAACAGCTTAAT-3'

    • 5'-CTCAGGCCAGAATCCACTATG-3'

  • Co-culture systems: Cell co-culture models are particularly valuable for studying Tmem176b interactions with immune cells. For example, CT26 colon cancer cells co-cultured with IL-2-exposed NK cells have been used to demonstrate that Tmem176b knockdown increases cancer cell apoptosis .

  • Inflammasome activation assays: Measuring IL-1β and IL-18 production as readouts of inflammasome activation in response to Tmem176b manipulation. ELISA for cytokine quantification and Western blotting for measuring expression of inflammasome components (NLRP3, ASC, caspase-1) provide robust methodological approaches .

What animal models are most appropriate for investigating Tmem176b in vivo?

Based on current research, effective animal models include:

  • Tmem176b knockout mice: Complete genetic deletion allows for studying the consequences of Tmem176b absence on inflammasome activation and immune responses. These models have revealed enhanced antitumor immunity and increased inflammasome activation .

  • Tmem176b/Casp1 double knockout mice: These models help delineate the dependence of Tmem176b effects on inflammasome activation. Research shows that the enhanced neutrophil recruitment seen in Tmem176b-/- mice is almost completely abolished in Tmem176b-/-Casp1-/- double knockout animals .

  • Tumor models in Tmem176b-manipulated backgrounds: Implantation of cancer cell lines (MC38, LL/2, EG7) in Tmem176b-/- mice has demonstrated enhanced tumor control compared to wild-type animals, highlighting the importance of this protein in regulating antitumor immunity .

  • Colorectal cancer in situ models: Male BALB/c mice (approximately 8 weeks old) with adenoviral vector-delivered shRNA targeting Tmem176b provide a suitable model for studying the effects of Tmem176b knockdown on colorectal cancer progression and metastasis .

How does Tmem176b regulate NLRP3 inflammasome activation?

Tmem176b functions as a negative regulator of the NLRP3 inflammasome through the following mechanisms:

  • Direct inhibition: Tmem176b inhibits the assembly and activation of the NLRP3 inflammasome complex. In the absence of Tmem176b (Tmem176b-/- mice), stimulation with NLRP3 activators like ATP and nigericin results in enhanced IL-1β production, indicating stronger inflammasome activation .

  • Ion flux regulation: As a transmembrane protein with ion channel properties, Tmem176b likely regulates cellular ion concentrations that affect inflammasome assembly and activation. The exact ionic mechanisms remain under investigation, but disruption of these channels appears to facilitate inflammasome activation.

  • Signaling pathway modulation: Tmem176b affects key signaling molecules involved in inflammasome regulation, including NF-κB signaling components. Research shows that silencing Tmem176b inhibits the expression of phosphorylated p65 (p-p65), a key component of the NF-κB pathway .

The regulatory relationship between Tmem176b and NLRP3 is bidirectional, as knockdown of NLRP3 can partially reverse the effects of Tmem176b silencing, suggesting a complex interplay between these proteins .

What is the role of Tmem176b in adaptive immune responses?

Tmem176b influences adaptive immunity through several mechanisms:

  • CD8+ T cell responses: Tmem176b deletion enhances CD8+ T cell-mediated tumor control. In Tmem176b-/- mice, tumor-infiltrating CD8+ T cells show increased proliferation when re-stimulated with antigen compared to wild-type animals .

  • CD4+ T cell differentiation: Absence of Tmem176b promotes the differentiation of TCRβ+CD4+RORγt+ cells (Th17-like cells) in tumor-draining lymph nodes. This effect is dependent on IL-1β, as anti-IL-1β treatment reduces this cell population in Tmem176b-/- mice .

  • Regulatory T cell balance: Tmem176b-/- mice exhibit decreased percentages (but not absolute numbers) of TCRβ+CD4+Foxp3+ regulatory T cells in tumor-draining lymph nodes, leading to an increased CD8/Treg ratio that favors antitumor immunity .

  • Inflammasome-dependent bridging of innate and adaptive immunity: Tmem176b serves as a checkpoint that links innate inflammasome activation to adaptive antitumor responses, with its absence enhancing this connection .

How does Tmem176b influence epithelial-mesenchymal transition (EMT) in cancer progression?

Tmem176b promotes epithelial-mesenchymal transition in cancer cells through several mechanisms:

  • Regulation of EMT markers: Silencing Tmem176b inhibits the expression of mesenchymal markers (N-cadherin, Vimentin) while enhancing the epithelial marker E-cadherin, indicating suppression of the EMT process .

  • Modulation of key signaling molecules: Tmem176b affects the expression of transforming growth factor-β (TGF-β) and matrix metallopeptidase 9 (MMP-9), which are critical regulators of EMT and cancer cell invasion. Knockdown of Tmem176b reduces the expression of these proteins .

  • NLRP3-dependent mechanism: The effects of Tmem176b on EMT are partially mediated through its interaction with the NLRP3 inflammasome. Knockdown of NLRP3 can partially antagonize the effects of Tmem176b silencing on EMT-related protein expression, suggesting that Tmem176b promotes EMT at least partly through inhibition of the NLRP3 inflammasome .

The EMT-promoting effects of Tmem176b contribute to its role in enhancing cancer cell migration, invasion, and metastasis, making it a potential target for inhibiting cancer progression.

What experimental approaches can determine the therapeutic potential of targeting Tmem176b in cancer?

Several experimental approaches can assess the therapeutic potential of Tmem176b targeting:

  • Combination with immune checkpoint inhibitors: Studies show that lack of Tmem176b enhances the antitumor activity of anti-CTLA-4 antibodies through mechanisms involving caspase-1/IL-1β activation. This suggests that Tmem176b inhibitors could potentiate the effects of established checkpoint blockers .

  • Pharmacological inhibition: Identification of BayK8644 as a TMEM176B inhibitor that promotes CD8+ T cell-mediated tumor control and reinforces the antitumor activity of both anti-CTLA-4 and anti-PD-1 antibodies provides a proof-of-concept for pharmacological targeting .

  • In vivo metastasis models: Using fluorescence imaging and morphological analyses to assess tumor metastasis following Tmem176b manipulation. Research has shown that shRNA-mediated silencing of Tmem176b reduces tumor metastasis in colorectal cancer models .

  • Immune cell functional assays: Measuring NK cell cytotoxicity and degranulation (CD107a expression) against tumor cells following Tmem176b manipulation provides insights into effects on innate antitumor immunity .

  • Tumor microenvironment analysis: Comprehensive analysis of immune cell infiltration, cytokine profiles, and inflammation signatures within tumors following Tmem176b targeting helps elucidate mechanisms of action and predict clinical efficacy.

How do Tmem176b genetic variants influence disease susceptibility and outcome?

Genetic variants of Tmem176b have been associated with disease susceptibility and outcomes:

Research in this area is still emerging, and comprehensive genomic and functional studies are needed to fully characterize how different Tmem176b variants affect disease processes and treatment responses.

What signaling pathways interact with Tmem176b to influence cellular processes?

Tmem176b interacts with several critical signaling pathways:

  • NF-κB signaling: Tmem176b affects phosphorylation of NF-κB p65, a key transcription factor involved in inflammation and cell survival. Silencing Tmem176b inhibits p-p65 expression, suggesting a positive regulatory relationship .

  • TGF-β pathway: Tmem176b manipulation affects TGF-β expression, a master regulator of EMT and cancer progression. Silencing Tmem176b reduces TGF-β expression, contributing to inhibition of EMT .

  • Phosphoinositide 3-kinase (PI3K) pathway: Previous studies have shown that TMEM176B promotes invasion of cancer cells via the PI3K pathway, suggesting a role in cell migration and invasion .

  • Inflammasome-mediated cytokine cascades: Through its inhibition of inflammasome activation, Tmem176b modulates downstream cytokine production (IL-1β, IL-18) that affects multiple cellular processes including immune cell recruitment and activation .

The complex interplay between these pathways underscores the multifaceted role of Tmem176b in cellular processes and highlights the potential for context-dependent effects depending on cell type and disease state.

What are the primary challenges in producing and working with recombinant Tmem176b protein?

Researchers face several challenges when working with recombinant Tmem176b:

  • Protein structure complexity: As a transmembrane protein, Tmem176b contains multiple membrane-spanning domains that make expression and purification challenging. Proper folding and maintenance of native conformation require specialized expression systems and purification protocols.

  • Functional assay development: Establishing reliable assays to measure ion channel function and inflammasome regulatory activity of recombinant Tmem176b requires specialized techniques and careful experimental design.

  • Antibody specificity: Developing specific antibodies for Tmem176b detection can be challenging due to potential cross-reactivity with related family members. Validation of antibody specificity is critical for reliable research outcomes.

Solutions include the use of mammalian expression systems for proper post-translational modifications, incorporation into artificial membrane systems for functional studies, and rigorous validation of reagents through multiple detection methods.

How can researchers effectively differentiate between the roles of Tmem176b and other related family members?

Differentiating between Tmem176b and related proteins requires several approaches:

  • Specific genetic manipulation: Using precisely targeted siRNA or shRNA sequences that specifically target Tmem176b while sparing related family members. The shRNA sequences mentioned earlier (e.g., 5'-CTAGCTGGAGTTGGTACTATT-3') have been validated for specific Tmem176b knockdown .

  • Double knockout models: Generating and comparing single knockout models of Tmem176b and related proteins, as well as double knockouts, helps delineate unique and overlapping functions. For example, comparing Tmem176b-/- with Tmem176b-/-Casp1-/- mice revealed that enhanced neutrophil recruitment in Tmem176b-/- mice is dependent on caspase-1 .

  • Rescue experiments: Performing rescue experiments by reintroducing Tmem176b or related family members in knockout models helps confirm specificity of observed phenotypes.

  • Domain-specific functional analysis: Conducting structure-function studies by manipulating specific domains of Tmem176b can help identify unique functional regions that differentiate it from related proteins.

What emerging technologies might advance our understanding of Tmem176b biology?

Several emerging technologies hold promise for advancing Tmem176b research:

  • Single-cell RNA sequencing: This technology can reveal cell-specific expression patterns of Tmem176b and related pathways across diverse cell populations within tissues. Previous studies have already utilized single-cell RNA sequencing to analyze TMEM176B and NLRP3/IL1B expression in macrophages infiltrating human melanoma, revealing important insights about the role of this axis in the tumor microenvironment .

  • CRISPR-Cas9 gene editing: Precise genetic manipulation of Tmem176b in various models can help elucidate its specific roles in different cellular contexts. CRISPR-based approaches allow for more refined genetic manipulations compared to traditional knockout methods.

  • Cryo-electron microscopy: Structural determination of Tmem176b and its complexes at atomic resolution can provide critical insights into its mechanism of action, potentially revealing new targetable sites for therapeutic development.

  • Spatial transcriptomics: This approach can map Tmem176b expression patterns within complex tissues while preserving spatial information, providing insights into its role in tissue organization and cell-cell interactions.

  • Protein interaction proteomics: Comprehensive identification of Tmem176b protein-protein interactions through advanced mass spectrometry approaches can reveal new functional relationships and regulatory mechanisms.

What are the most promising therapeutic applications targeting Tmem176b in disease?

Promising therapeutic directions for Tmem176b targeting include:

  • Cancer immunotherapy enhancement: Tmem176b inhibitors like BayK8644 have shown potential to promote CD8+ T cell-mediated tumor control and reinforce the antitumor activity of immune checkpoint blockers (anti-CTLA-4 and anti-PD-1 antibodies) . This suggests that pharmacological de-repression of the inflammasome by targeting Tmem176b may enhance the therapeutic efficacy of established immunotherapies, potentially addressing resistance issues.

  • Metastasis prevention: Given the role of Tmem176b in promoting EMT and cancer cell invasion, targeted inhibition might reduce metastatic spread. Research has shown that silencing Tmem176b inhibits tumor metastasis, proliferation, and EMT in colorectal cancer models .

  • Inflammatory disease modulation: While most current research focuses on cancer applications, the fundamental role of Tmem176b in inflammasome regulation suggests potential applications in inflammatory diseases where inflammasome activity needs to be precisely controlled.

  • Combination approaches: Strategies combining Tmem176b inhibition with other immunomodulatory agents or conventional therapies might produce synergistic effects, potentially allowing for dose reduction of more toxic agents.

Development of highly specific Tmem176b inhibitors with favorable pharmacokinetic properties represents a critical next step in translating these findings toward clinical applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.