Recombinant Rat Transmembrane protein 178 (Tmem178)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Tmem178a; Tmem178; Transmembrane protein 178A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
26-297
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Tmem178a
Target Protein Sequence
IFTDHWYETDPRRHKESCERSRAGADPPDQKNRLMPLSHLPLRDSPPLGRRLLPGGPGRS DPESWRSLLGLGGLDAECGRPLFATYSGLWRKCYFLGIDRDIDTLILKGIAQRCTAVKYH FSQPIRLRNIPFNLTKIIQQDEWHLLHLRRITAGFLGMAVAVLLCGCIVATVSFFWEESL TQHVAGLLFLMTGIFCTISLCTYAASVSYDLNRVPKLIYSLPHDVEHGYSWSIFCAWCSL GFIVAAGGLCIAYPFISRTKIAHLKSGRDSTV
Uniprot No.

Target Background

Function
This protein acts as a negative regulator of osteoclast differentiation under both basal and inflammatory conditions. This regulation is achieved by modulating TNFSF11-induced Ca2+ fluxes, thereby controlling the induction of NFATC1.
Database Links
Protein Families
TMEM178 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Tmem178 and what is its primary cellular function?

Tmem178 is a transmembrane protein that functions as a negative regulator of osteoclast differentiation in both basal and inflammatory conditions. It exerts its inhibitory effects by controlling nuclear factor of activated T-cells, cytoplasmic 1 (NFATc1) induction through modulation of calcium (Ca²⁺) signaling pathways . Tmem178 represents a novel feedback mechanism in the osteoclastogenesis pathway, where it is initially induced by RANKL signaling through PLCγ2 and NFATc1, and then acts to restrain further NFATc1 activation to prevent excessive osteoclast formation . This regulatory function is particularly important for maintaining skeletal mass and limiting pathological bone loss during inflammatory conditions.

Where is Tmem178 localized within cells?

Immunofluorescence studies have definitively demonstrated that Tmem178 localizes to the endoplasmic reticulum (ER) membrane but is not present at the plasma membrane in mature osteoclasts . This specific subcellular localization is consistent with its function in regulating ER Ca²⁺ mobilization, which is a critical step in the NFATc1 signaling pathway during osteoclastogenesis . The ER localization positions Tmem178 to interact with other ER-resident proteins involved in calcium homeostasis, particularly Stim1, which functions as an ER Ca²⁺ sensor controlling calcium fluxes during osteoclast formation.

How is Tmem178 expression regulated during cellular differentiation?

Tmem178 expression significantly increases during osteoclastogenesis and is dependent on PLCγ2 signaling . Analysis of Tmem178 mRNA levels shows progressive upregulation in wild-type bone marrow macrophages (BMMs) treated with RANKL, while this induction is absent in PLCγ2-deficient cells . Similar Tmem178 induction patterns are observed in human CD14⁺ monocytes treated with RANKL compared to cells treated with M-CSF alone . The Tmem178 promoter contains NFAT consensus binding sites, and studies with NFATc1-deficient cells confirm that RANKL-induced Tmem178 upregulation is significantly blunted in the absence of NFATc1 . Additionally, cell adhesion can induce Tmem178 expression in a process partially dependent on the classical NF-κB subunit p65 . Importantly, Tmem178 is not significantly expressed in osteoblasts, confirming its lineage-specific role in osteoclast biology .

What is the mechanism by which Tmem178 regulates calcium signaling?

Tmem178 negatively regulates store-operated calcium entry (SOCE) by interacting with Stim1, an ER Ca²⁺ sensor . When examining Ca²⁺ oscillations in response to RANKL stimulation, Tmem178-deficient osteoclast precursors display significantly enhanced Ca²⁺ oscillations compared to wild-type cells . This leads to increased activation and nuclear translocation of NFATc1, a Ca²⁺-dependent transcription factor essential for osteoclastogenesis .

Mechanistically, Tmem178 binds to Stim1 in resting conditions and to a lesser extent in the presence of thapsigargin (Tg) and Tg + 1.8 mM Ca²⁺ . This interaction occurs independently of Orai1, as no direct binding between Tmem178 and Orai1 was detected, and Tmem178 does not affect Stim1 coupling to Orai1 . This suggests that Tmem178 modulates Ca²⁺ signaling by directly influencing Stim1 function at the ER, rather than affecting the formation of Stim1-Orai1 complexes that mediate SOCE.

How does the structural organization of Tmem178 contribute to its function?

Tmem178 contains multiple transmembrane domains that are critical for its proper localization to the ER membrane and its interaction with binding partners such as Stim1 . Mutagenesis experiments have been conducted to understand structure-function relationships, with specific constructs including:

Tmem178 ConstructModificationFunction
Tmem178ΔNTDeletion of TM1 plus N-terminal loop (618-974 bp)Affects membrane topology and protein interactions
Tmem178ΔCTDeletion of the C-terminal region (81-914 bp)Alters binding capacity to partner proteins
Full-length Tmem178Complete protein with HA-tag at C-terminusMaintains normal inhibitory function

These constructs have been used in retroviral expression systems to study how different domains contribute to Tmem178's ability to interact with Stim1 and regulate calcium signaling . Experiments suggest that specific regions within Tmem178 are required for its proper function as a negative regulator of calcium flux and osteoclastogenesis.

What phenotype do Tmem178-knockout mice exhibit and how does it differ from expected outcomes?

Contrary to initial expectations, Tmem178-knockout mice display a surprisingly divergent phenotype from PLCγ2-knockout mice. While PLCγ2-deficient mice exhibit an osteopetrotic phenotype (increased bone mass), 16-week-old female Tmem178⁻/⁻ mice show a 35% decrease in trabecular bone volume with significant trabecular thinning compared to wild-type littermates . Histological analysis using tartrate-resistant acid phosphatase (TRAP) staining reveals a significant increase in osteoclast surface normalized to bone surface in Tmem178⁻/⁻ mice .

The bone loss phenotype in Tmem178-deficient mice is specifically due to enhanced osteoclastogenesis, as osteoblast numbers are equivalent between genotypes . Supporting this, the mineral apposition rate (MAR), bone formation rate (BFR), and RANKL and OPG mRNA levels in whole bones flushed of marrow cells are similar between wild-type and Tmem178⁻/⁻ mice . These findings establish Tmem178 as an important negative regulator of osteoclast differentiation that functions in an unexpected negative feedback loop downstream of PLCγ2 to maintain proper bone homeostasis.

How does Tmem178 deficiency affect inflammatory bone loss?

Tmem178-deficient mice are significantly more susceptible to inflammatory bone loss compared to wild-type counterparts . When challenged with inflammatory stimuli:

  • In vitro, Tmem178⁻/⁻ osteoclast precursors show exacerbated osteoclast differentiation when treated with TNF-α or LPS .

  • In vivo, Tmem178⁻/⁻ mice injected with LPS over the calvaria develop profound focal osteolysis and increased osteoclast surface compared to wild-type mice .

  • In the K/BxN serum-transfer arthritis model, while both genotypes develop equivalent inflammatory responses (measured by paw thickness), Tmem178⁻/⁻ mice suffer significantly more bone loss at the knee, driven by increased osteoclast differentiation .

These findings demonstrate that Tmem178 plays a crucial role in restraining inflammatory bone loss by limiting osteoclast formation during inflammatory conditions, suggesting its potential relevance in human inflammatory bone diseases.

What are the established methods for studying Tmem178 expression and function?

MethodologyApplicationKey Considerations
RT-qPCRQuantifying Tmem178 mRNA expressionUse validated primers spanning exon-exon junctions
ImmunofluorescenceDetermining subcellular localizationRequires validated antibodies or epitope-tagged constructs
Co-immunoprecipitationIdentifying protein-protein interactionsCan be performed with HA/Myc-tagged constructs
Calcium imagingMeasuring intracellular Ca²⁺ oscillationsUse fluorescent indicators like Fura-2
Retroviral expressionExpressing wild-type or mutant Tmem178PLAT-E cells for virus production, polybrene for infection
TRAP stainingQuantifying osteoclast formationIdentifies multinucleated TRAP+ cells
Bone resorption assaysAssessing osteoclast functionCulture on bone slices to measure resorption pits
Nuclear/cytoplasmic fractionationMeasuring NFATc1 nuclear translocationWestern blot analysis of fractionated cell extracts

For gene silencing experiments, researchers typically use siRNAs or shRNAs targeting specific regions of Tmem178. For overexpression studies, retroviral vectors containing Tmem178 cDNA with epitope tags (e.g., HA) can be used to infect bone marrow macrophages, followed by selection with appropriate antibiotics . When generating Tmem178 mutants, overlapping PCR techniques are commonly employed, and constructs often contain C-terminal epitope tags for detection .

How can researchers generate and validate Tmem178 mutants for structure-function studies?

Researchers can generate Tmem178 mutants through overlapping PCR techniques to delete specific domains or introduce point mutations . The protocol involves:

  • Amplifying segments of Tmem178 cDNA with primers containing the desired mutations.

  • Inserting the mutated constructs into appropriate retroviral vectors (e.g., pMX-blasticidin) using restriction enzymes such as BamH1/Xho1 .

  • Adding epitope tags (e.g., HA-tag) at the C-terminal end to facilitate detection .

  • Transfecting packaging cells (e.g., PLAT-E cells) with the constructs to generate retroviruses .

  • Infecting bone marrow macrophages with the retroviruses in medium containing M-CSF and polybrene .

  • Selecting infected cells with appropriate antibiotics (e.g., 1 ng/ml blasticidin for 48 hours) .

Common Tmem178 mutants include Tmem178ΔNT (deletion of TM1 plus N-terminal loop, 618–974 bp) and Tmem178ΔCT (deletion of the C-terminal region, 81–914 bp) . These mutants should be validated by confirming their expression levels, subcellular localization, and ability to interact with binding partners such as Stim1 using co-immunoprecipitation and immunofluorescence techniques .

What is the relevance of Tmem178 in human inflammatory bone diseases?

Tmem178 has significant potential relevance in human inflammatory bone diseases, particularly in conditions like systemic juvenile idiopathic arthritis (sJIA) . Research has shown that Tmem178 expression is significantly reduced in human CD14⁺ monocytes exposed to plasma from sJIA patients . This reduced expression correlates with excessive osteoclastogenesis, mirroring the observations in the Tmem178-knockout mouse model .

Bone erosion and systemic bone loss were historically observed in up to 50% of children with sJIA in the pre-biologic era, and even with recent advances, joint damage remains a significant problem for at least 20% of these patients despite remission of systemic inflammation . Currently, there are no established markers to identify which sJIA patients will develop erosive disease, and delayed diagnosis often contributes to the development of erosive changes .

Additionally, Stim1 single nucleotide polymorphisms (SNPs) have been identified in patients with ankylosing spondylitis (AS), a chronic inflammatory disease of the spine and joints . These SNPs correlate with significantly higher inflammatory markers, including C-reactive protein and, in some cases, higher circulating levels of TNF-α and IL-6 . Given that Tmem178 interacts with Stim1, these findings suggest potential connections between Tmem178 dysfunction and various inflammatory bone pathologies.

How might targeting Tmem178 pathways provide therapeutic opportunities?

Understanding the Tmem178 regulatory pathway presents several potential therapeutic opportunities for inflammatory bone diseases:

  • Enhancing Tmem178 expression or function: Since decreased Tmem178 expression correlates with excessive osteoclastogenesis in both mouse models and human inflammatory conditions, strategies to upregulate Tmem178 or enhance its function could help restrain pathological bone loss .

  • Targeting the Tmem178-Stim1 interaction: Modulating the interaction between Tmem178 and Stim1 could provide a novel approach to regulate calcium signaling in osteoclast precursors, potentially limiting NFATc1 activation and subsequent osteoclast differentiation .

  • Developing biomarkers: Measuring Tmem178 expression levels in monocytes could potentially serve as a biomarker to identify patients at higher risk for developing erosive bone disease in conditions like sJIA, allowing for earlier intervention .

  • Combination therapies: Targeting Tmem178 pathways could potentially complement existing anti-inflammatory or anti-osteoclastogenic therapies, providing more comprehensive control of bone loss in inflammatory conditions .

The specificity of Tmem178 expression in osteoclast lineage cells and its minimal expression in osteoblasts suggests that targeting this pathway might allow for selective inhibition of bone resorption without directly affecting bone formation, which could be advantageous compared to some current anti-resorptive therapies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.