Recombinant Rat Transmembrane protein 18 (Tmem18)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for your consideration.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Tmem18; Transmembrane protein 18
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-140
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Tmem18
Target Protein Sequence
MASPYSVRVFPVSIPAVIMETDWTEPWLLGLLAFHLLCLLLTCFSAQRYKLQIGHFLCLV VLVYCAEYINEVAAMNWRLFAKYQYFDSRGMFISLVFSAPLLFNAMVIVIMWVRKTLTVM SDLKNLQERRKERKRRRKEE
Uniprot No.

Target Background

Function

Function: Recombinant Rat Transmembrane protein 18 (TMEM18) functions as a transcription repressor and sequence-specific single-stranded (ssDNA) and double-stranded (dsDNA) binding protein, exhibiting a preference for GCT and CTG repeat sequences. It also modulates cell migration, specifically enhancing the migratory capacity of glioma-specific neural stem cells (NSCs) and neural precursor cells (NPCs).

Gene References Into Functions

Supporting Evidence:

  1. A strong positive correlation (r = 0.5694, P = 0.0003) was observed between TMEM18 expression and body weight in the prefrontal cortex (PFC), suggesting a potential role in PFC-mediated higher-order functions related to feeding behavior. PMID: 21952719
Database Links
Protein Families
TMEM18 family
Subcellular Location
Cytoplasm. Nucleus membrane; Multi-pass membrane protein.

Q&A

What is TMEM18 and why is it significant for obesity research?

TMEM18 is a transmembrane protein encoded by the TMEM18 gene, which has been consistently identified in genome-wide association studies (GWAS) as one of the strongest genetic factors associated with obesity in both children and adults. The significance of TMEM18 stems from its role in the central control of appetite and energy homeostasis.

Multiple studies have demonstrated a strong association between variants near the TMEM18 gene on human chromosome 2 (2p25.3) and increased BMI. This association has been repeatedly validated in diverse populations, with the effects more pronounced in children compared to adults . The molecular mechanisms by which TMEM18 influences body weight regulation are still being elucidated, making it an important target for obesity research.

What is the cellular localization and structure of TMEM18?

TMEM18 is primarily localized to the nuclear membrane. Initially described as a three-transmembrane protein, recent research has provided evidence that it actually contains four transmembrane domains .

Phylogenetic analysis has revealed remote but clear homology between TMEM18 and various ion channels, including proteins from fungal transient receptor potential ion channels and bacterial mechanosensitive ion channels . The current structural model suggests that TMEM18 exposes both its termini to the cytoplasm, consistent with its four transmembrane topology.

Table 1: Key Structural Features of TMEM18

FeatureDescriptionEvidence
Transmembrane domainsFour (not three as previously thought)Phylogenetic analysis and experimental verification
LocalizationNuclear membraneImmunofluorescence studies
Molecular interactionsNuclear pore complex components (NDC1, AAAS, NUP35/53)Affinity purification and mass spectrometry
DNA bindingSequence-specific binding to GCT nucleotide tripletsElectrophoretic mobility shift assay (EMSA)

How does TMEM18 expression vary across tissues and under different nutritional states?

TMEM18 is expressed in various brain regions, particularly in hypothalamic nuclei involved in appetite regulation. RNA-Seq analysis of laser-capture microdissected tissue from four hypothalamic nuclei (arcuate, ventral medial, paraventricular, and dorsal medial) has confirmed TMEM18 expression in all these regions .

What are the optimal methods for expressing and purifying recombinant rat TMEM18?

For successful expression and purification of recombinant rat TMEM18, consider the following methodological approach:

  • Expression System Selection: Due to TMEM18's multiple transmembrane domains, mammalian expression systems (such as HEK293 cells) are generally preferred over bacterial systems. This allows for proper folding and post-translational modifications.

  • Construct Design:

    • Include an appropriate tag (His-tag, FLAG-tag) for purification

    • Consider using only the C-terminal domain for studies focused on DNA binding

    • For full-length protein, ensure the signal sequence is properly included

  • Purification Strategy:

    • Use detergent-based extraction (e.g., with DDM as used in EMSA studies)

    • Employ affinity chromatography based on the chosen tag

    • Consider size exclusion chromatography as a final purification step

  • Verification of Structural Integrity: Confirm proper folding and membrane integration using circular dichroism spectroscopy or limited proteolysis.

What gene targeting approaches have been successful for studying TMEM18 function in vivo?

Several approaches have proven effective for manipulating TMEM18 expression in animal models:

  • Germline Knockout Models:

    • Knockout mice carrying the mutant allele tm1a(EUCOMM)Wtsi Tmem18 have been generated on a C57BL/6 genetic background through the European Conditional Mouse Mutagenesis Program (EUCOMM) .

    • This approach disrupts exon 2 of Tmem18 and results in very low residual TMEM18 transcript levels in homozygous mice (approximately 2.1% ± 1.4% of normal expression) .

  • Adeno-Associated Viral (AAV) Vector-Mediated Overexpression:

    • Bilateral injections of AAV-Tmem18-cDNA into the paraventricular nucleus (PVN) of adult mice have successfully increased TMEM18 expression approximately two-fold .

    • This approach allows for region-specific manipulation of TMEM18 expression in adult animals.

  • siRNA Knockdown:

    • While mentioned in the literature, siRNA approaches for TMEM18 knockdown in the PVN have proven challenging despite promising preliminary results in vitro .

Table 2: Comparison of TMEM18 Genetic Manipulation Approaches

ApproachAdvantagesLimitationsKey Findings
Germline knockoutComplete loss of function throughout developmentPotential developmental compensation; cannot isolate tissue-specific effectsIncreased body weight, particularly in males on HFD; hyperphagia
AAV-mediated overexpressionRegion-specific; temporal control; applicable to adult animalsLimited to targeting accessible brain regionsReduced food intake; increased energy expenditure; reduced weight gain
Conditional knockoutTissue-specific and temporal controlRequires multiple genetic crosses; lower efficiencyNot yet widely reported for TMEM18

How does TMEM18 mechanistically contribute to transcriptional regulation?

TMEM18 functions as a sequence-specific DNA-binding protein that appears to repress transcription. The underlying mechanisms include:

  • Direct DNA Binding: TMEM18 binds to DNA with its C-terminus in a sequence-specific manner, preferentially targeting GCT nucleotide triplets . While this binding motif may appear inadequate on a genomic scale for specific interactions, TMEM18 dimerization increases binding affinity and potentially extends the length of its target sequence.

  • Tethering DNA to Nuclear Membrane: As a nuclear membrane protein, TMEM18 is hypothesized to tether DNA to the nuclear periphery. When TMEM18 binds to DNA, it would leave no space between the DNA and nuclear membrane for interactions with transcription machinery, potentially explaining its repressive effect on gene expression .

  • Interaction with Nuclear Pore Complex Components: TMEM18 physically interacts with key components of the nuclear pore complex, including NDC1, AAAS, and NUP35/53, as demonstrated through affinity purification, mass spectrometry, and biomolecular immunofluorescence complementation assays . These interactions may contribute to its regulatory functions.

What are the sex-specific differences in TMEM18 function and how should they be considered in experimental design?

Studies have reported notable sex-specific differences in TMEM18 function that should be carefully considered when designing experiments:

  • Dimorphic Phenotype in Knockout Models: Male TMEM18-deficient mice show increased body weight due to increases in both fat and lean mass, while female knockouts show no significant differences in body weight or body composition compared to wild-type littermates .

  • Diet-Specific Effects: On a high-fat diet (HFD), the sex-specific difference becomes more pronounced. Male TMEM18-null mice gain significantly more weight on an HFD due to hyperphagia, while females remain comparable to wild-type controls .

  • Potential Mechanisms: The mechanisms behind these sex-specific differences remain to be fully determined, but circulating gonadal hormones, particularly estrogen, may play a crucial role. Research has shown that estradiol treatment can prevent increases in adipose tissue mass in male mice fed an obesogenic diet .

Recommendations for Experimental Design:

  • Include both sexes in TMEM18 studies and analyze data separately

  • Control for estrous cycle in female subjects

  • Consider gonadectomized groups with hormone replacement to isolate hormonal effects

  • Include diet as a key variable that may interact with sex

How can researchers distinguish between direct TMEM18 effects and potential compensatory mechanisms in knockout models?

Distinguishing direct TMEM18 effects from compensatory mechanisms requires a multi-faceted approach:

  • Temporal Control of Gene Expression:

    • Use inducible knockout systems (e.g., tamoxifen-inducible Cre) to delete TMEM18 in adult animals

    • Compare phenotypes between germline knockouts and adult-induced knockouts

    • The rapid weight loss observed in AAV-mediated TMEM18 overexpression models suggests direct effects

  • Transcriptome Analysis:

    • Compare gene expression profiles between wild-type, constitutive knockout, and acute knockdown models

    • Identify differentially expressed genes that appear only in constitutive knockouts as potential compensatory mechanisms

  • Pathway Analysis:

    • Examine known appetite and energy expenditure pathways for alterations

    • For example, male TMEM18-deficient mice show increased energy expenditure (approximately 7% higher) alongside hyperphagia (13.9% increase in food intake) , suggesting compensatory thermogenesis

  • Tissue-Specific Manipulation:

    • Use Cre drivers for specific neuronal populations (e.g., Sim1-Cre, Agrp-Cre) to delete TMEM18 in defined cell types

    • Compare phenotypes between global and cell type-specific knockouts

How can researchers address the technical challenges of studying membrane proteins like TMEM18?

Membrane proteins present specific technical challenges that require specialized approaches:

  • Solubilization Strategies:

    • Use mild detergents such as n-Dodecyl β-D-maltoside (DDM) for extraction

    • Consider nanodiscs or amphipols for maintaining native-like environment

    • For EMSA experiments with TMEM18, include 0.05% DDM in the binding buffer

  • Structural Analysis Approaches:

    • Traditional crystallography is challenging; consider cryo-EM

    • Use cross-linking mass spectrometry to identify interaction interfaces

    • Employ computational modeling based on homologous proteins (as done for TMEM18's structural prediction based on ion channels)

  • Functional Assays:

    • For DNA binding studies, ensure proper protein folding in the presence of detergents

    • When studying transcriptional effects, use reporter constructs with multiple TMEM18 binding sites

    • For protein interactions, consider split-GFP or BRET assays in living cells

What environmental factors should be controlled when studying TMEM18's effects on metabolism?

Several environmental factors significantly impact metabolic phenotypes in TMEM18 studies:

  • Ambient Temperature:

    • Housing temperature can qualitatively affect metabolic outcomes

    • Studies on TMEM18-deficient mice conducted under standard animal house conditions (typically around 22°C) represent a chronic thermal stress that may confound results

    • Future studies at thermoneutrality (approximately 30°C for mice) may help elucidate TMEM18's true role in metabolic control

  • Diet Composition:

    • The phenotype of TMEM18-deficient mice is exacerbated by high-fat diet

    • Consider using both standard chow and high-fat diet groups

    • Diet composition affects "diet-induced thermogenesis," where mice simultaneously increase energy expenditure and food intake

  • Housing Conditions:

    • Individual versus group housing affects feeding behavior

    • Food intake assessment should account for housing conditions

    • TMEM18-deficient mice show increased food intake when individually housed in home cages and during indirect calorimetry measurements

  • Circadian Timing:

    • TMEM18 effects may vary with circadian rhythms

    • Time food intake measurements and tissue collection consistently

    • Consider continuous monitoring systems for more comprehensive assessment

What are the most promising approaches for translating TMEM18 research to human obesity therapeutics?

Several promising approaches could translate TMEM18 research to human therapeutics:

  • Targeted Gene Therapy:

    • AAV-mediated overexpression of TMEM18 in the PVN has shown efficacy in reducing food intake and increasing energy expenditure in mice

    • Region-specific delivery to hypothalamic nuclei could potentially be adapted for human application

  • Small Molecule Modulators:

    • Identifying compounds that enhance TMEM18 expression or activity

    • Screening for molecules that mimic TMEM18's effects on downstream pathways

    • Development of drugs targeting specific TMEM18-DNA interactions

  • Genetic Risk Stratification:

    • Using TMEM18 SNPs for obesity risk prediction

    • Tailoring lifestyle interventions based on TMEM18 genotype

    • Research suggests TMEM18 variants interact with modifiable factors like physical activity and drinking habits

How might TMEM18 interact with other obesity-associated genes at the molecular and physiological levels?

Understanding TMEM18's interactions with other obesity-associated genes is crucial for developing comprehensive therapeutic approaches:

  • Gene-Gene Interactions:

    • Studies have investigated potential interactions between TMEM18 and other obesity-associated genes such as FTO, MC4R, and SH2B1

    • While some studies found no evidence for a direct interaction between these polymorphisms, their combined effects on obesity risk merit further investigation

  • Pathway Integration:

    • TMEM18 likely functions within broader energy homeostasis networks

    • Its nuclear membrane localization and interactions with nuclear pore complex components suggest potential crosstalk with transcriptional regulation pathways affected by other obesity genes

    • Investigation of shared downstream targets could reveal points of convergence

  • Brain Region-Specific Interactions:

    • Different obesity genes may act predominantly in distinct brain regions

    • For instance, TMEM18 expression in the prefrontal cortex shows a strong positive correlation with body weight (r = 0.5694, P = 0.0003) , suggesting a role in higher cognitive functions related to feeding behavior

    • Mapping region-specific expression and function of obesity genes could reveal anatomical points of interaction

What methodological advances are needed to better understand TMEM18's role in specific neuronal populations?

Several methodological advances would significantly enhance our understanding of TMEM18's role in neuronal circuits:

  • Cell Type-Specific Manipulation:

    • Development of Cre driver lines targeting specific hypothalamic neuronal populations expressing TMEM18

    • Implementation of intersectional genetic approaches to manipulate TMEM18 in defined neuronal subtypes

    • Future studies with specific anatomical Cre drivers (e.g., Sim1-Cre, Agrp-Cre) would help delineate TMEM18's role in both hypothalamic nuclei and specific neuronal populations

  • Circuit Mapping Techniques:

    • Application of techniques like CLARITY, expansion microscopy, and array tomography to map TMEM18-expressing neurons

    • Use of trans-synaptic tracers to identify inputs to and outputs from TMEM18-expressing neurons

    • Implementation of calcium imaging to assess activity patterns in these neuronal populations

  • Single-Cell Approaches:

    • Single-cell RNA sequencing to identify the transcriptional profile of TMEM18-expressing neurons

    • Patch-clamp electrophysiology to characterize the functional properties of these neurons

    • Development of TMEM18-specific reporters for live-cell imaging

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.