Recombinant Rat Transmembrane protein 192 (Tmem192)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rat Transmembrane Protein 192 (Tmem192)

Tmem192 is a lysosomal membrane protein characterized by four transmembrane domains, cytosolic N- and C-termini, and homodimerization . Its lysosomal localization is mediated by dileucine motifs, and it is implicated in autophagy regulation, apoptosis, and cellular stress responses . While most functional studies focus on human and murine orthologs, the rat Tmem192 shares conserved structural and functional features, including a molecular weight of ~68 kDa and tissue-specific expression patterns . Recombinant Tmem192 is typically produced in bacterial or mammalian systems for structural and functional analyses.

Tissue Distribution in Rats

Tmem192 exhibits tissue-specific expression, with prominent localization in lysosomal membranes across multiple organs. Key findings include:

Tissue/OrganExpression LevelSubcellular Localization
Brain (Hippocampus)HighLate endosomes/lysosomes
LiverModerateLysosomal membrane
KidneyModerateLate endosomes
Spleen, IntestineLowNot detected

Note: Rat Tmem192 is absent from the endoplasmic reticulum, Golgi apparatus, and plasma membrane .

Key Functional Pathways

Tmem192 influences cellular homeostasis through:

PathwayMechanismExperimental Evidence
ApoptosisUpregulation of Bax, caspase-3, and p38 MAPK phosphorylationTMEM192 knockdown in human hepatoma cells induces apoptosis .
AutophagyActivation of LC3-II conjugation and autophagosome formationTMEM192-deficient cells show increased LC3-II levels .
ER StressCaspase-12 activation via ER stress signalingCaspase-12 cleavage observed in TMEM192-silenced human cells .

Protein Characteristics

PropertyDetailReference
Molecular Weight68 kDa (observed), 30.9 kDa (calculated)
HomologyConserved across mammals (human, mouse, rat)
Antibody ReactivityRabbit polyclonal antibodies (e.g., Boster A11938) detect both isoforms

Recombinant Applications

Recombinant Tmem192 is used for:

  1. Structural Studies: Crystallization and homodimerization analysis.

  2. Functional Assays: Autophagy and apoptosis induction in cell models.

  3. Antibody Validation: Confirming lysosomal localization via immunofluorescence .

Human/Mouse Insights Informing Rat Studies

  • Knockout Models: Murine Tmem192-/- mice show no overt lysosomal dysfunction, suggesting compensatory mechanisms .

  • Tumor Relevance: High Tmem192 expression in tumors correlates with growth inhibition upon knockdown, suggesting therapeutic potential .

Unanswered Questions

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request whenever possible.
Lead Time
Delivery times may vary based on the purchase method or location. Please consult your local distributor for specific delivery information.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are collected at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. This can be used as a reference for your own preparations.
Shelf Life
The shelf life of our products is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize development according to your specifications.
Synonyms
Tmem192; Transmembrane protein 192
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-266
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Tmem192
Target Protein Sequence
MAAGGRLEDGSLDILQSTDDDPLLDTQPLPHHSLHAHFRPRFHPLPTVIIANLLLLIHVV FVTLAFLTGVLCLYPDPNEDKCPENYTNPLKVQTAIILGKVILWILHLLFERYIQYHHRK VRSRGYSQIYRSTRHLKALALTIHSSGNTALLLLLCVQYSFPEPNKLYLELILAVLALEL ICSLSCLVLYTVKIRRFNKAKPQPDVLEEEKCYAYPSNIASETGFRTVSSLEEIVEKQGD IIVYLKRHNALLSKRLLELATQPART
Uniprot No.

Target Background

Database Links
Protein Families
TMEM192 family
Subcellular Location
Lysosome membrane; Multi-pass membrane protein. Late endosome.

Q&A

What is Transmembrane Protein 192 (Tmem192) and what is its cellular localization?

Tmem192 is a lysosomal/late endosomal protein initially discovered through organellar proteomics. This protein specifically localizes to late endosomal/lysosomal membranes, which is crucial for its function within the endolysosomal system. The localization of Tmem192 to these compartments is mediated by two dileucine motifs present at the amino-terminus of the protein. These motifs serve as targeting signals that direct the protein to its proper cellular location. Immunofluorescence studies using co-localization with established markers such as LAMP-2 have confirmed its residence in lysosomes . Understanding the precise cellular localization of Tmem192 provides important insights into its potential role in lysosomal function, membrane organization, and related cellular processes.

What are the structural characteristics of Tmem192?

Tmem192 exhibits a distinctive membrane topology characterized by four transmembrane segments with both N- and C-termini facing the cytosol. The human and murine Tmem192 proteins comprise 271 and 266 amino acids respectively, sharing approximately 78% sequence identity . A notable structural feature of Tmem192 is its ability to form homodimers, which in human Tmem192 are interconnected by disulfide bridges. This dimerization is mediated by a cysteine residue near the carboxy terminus that facilitates disulfide bond formation .

The protein has a calculated molecular weight of approximately 31 kDa, although it typically appears at different molecular weights on Western blots, with observations reporting apparent molecular weights from 35 kDa up to 68 kDa . This discrepancy may be attributed to post-translational modifications such as N-glycosylation, for which murine Tmem192 exhibits two potential consensus sites (N76PT, N85YT), though only the second site is likely utilized due to the proline in the first site .

How is Tmem192 detected in laboratory settings?

Tmem192 can be detected through several laboratory techniques, primarily using specific antibodies. Commercial antibodies are available for detection of Tmem192 from different species, including rat, mouse, and human variants . Western blotting is commonly used to detect Tmem192, where it typically appears as a band of approximately 31-35 kDa, though the observed molecular weight may vary depending on post-translational modifications .

Immunofluorescence microscopy is another valuable technique for visualizing the subcellular localization of Tmem192, particularly its co-localization with lysosomal markers such as LAMP-2 . Flow cytometry with intracellular staining can also be employed for quantitative analysis of Tmem192 expression in cell populations .

When selecting detection methods, it's important to note that antibodies raised against one species may not cross-react with Tmem192 from other species, necessitating careful selection of species-specific antibodies. For instance, some antibodies against human TMEM192 do not recognize the murine protein, requiring the development of species-specific antisera .

What is the tissue distribution pattern of Tmem192 expression?

Tmem192 demonstrates a ubiquitous expression pattern across various tissues, although with notable variations in expression levels. Western blot analyses of protein lysates from different organs have revealed that Tmem192 is most strongly expressed in bone marrow, thymus, spleen, kidney, and brain . Comparatively weaker expression has been observed in spinal cord, liver, lung, and sciatic nerve .

In the brain, Tmem192 expression is particularly pronounced in the hippocampus but is also present in the cortex and cerebellum . This differential expression pattern suggests tissue-specific roles for Tmem192, potentially related to the varying demands for lysosomal function across different cell types. The widespread but variable expression of Tmem192 across tissues indicates its fundamental importance in cellular physiology while suggesting context-dependent functions that may be more critical in certain tissues than others.

How do murine and human Tmem192 compare in terms of structure and function?

Murine and human Tmem192 share significant structural and functional similarities while exhibiting some distinct characteristics. At the primary sequence level, the proteins share approximately 78% amino acid identity, with murine Tmem192 comprising 266 amino acids compared to 271 in the human orthologue . Both proteins display the same predicted topology with four transmembrane segments and cytosol-facing N- and C-termini.

A key shared functional characteristic is their localization to late endosomal/lysosomal membranes, indicating conserved targeting mechanisms. Both orthologues can form homodimers, though this process is mediated by disulfide bridges in the human protein . An important consideration for experimental design is that antibodies raised against human Tmem192 often do not cross-react with the murine protein, necessitating species-specific detection tools .

Despite these differences, the high degree of conservation suggests similar core functions in the endolysosomal system across species, making mouse models valuable for investigating the physiological roles of Tmem192.

What are the methodological approaches for studying Tmem192 in lysosomes?

Investigating Tmem192's role in lysosomal biology requires a multifaceted methodological approach combining molecular, cellular, and biochemical techniques. Co-localization studies using confocal microscopy with established lysosomal markers such as LAMP-2, Cathepsin D, or lysobisphosphatidic acid (LBPA) can confirm lysosomal residence and reveal potential alterations in lysosomal morphology or distribution .

Lysosomal function can be assessed through measurement of lysosomal enzyme activities, such as β-hexosaminidase, in wild-type versus Tmem192-deficient systems . For studying lysosomal dynamics, researchers can employ methods that assess lysosomal exocytosis, such as measuring the translocation of lysosomal contents to the plasma membrane following calcium ionophore treatment.

Autophagy studies, including monitoring LC3 conversion (LC3-I to LC3-II ratio) and p62 degradation by Western blotting, can reveal potential impacts on autophagosome-lysosome fusion or autophagic flux . Additionally, inhibitor studies using compounds that affect lysosomal acidification (e.g., Bafilomycin A1) or lysosomal proteases (e.g., leupeptin, E64d) can help elucidate the relationship between Tmem192 and specific lysosomal functions .

How does Tmem192 deficiency affect lysosomal function and autophagy?

Studies examining TMEM192-deficient mouse embryonic fibroblasts (MEFs) have provided insights into the consequences of Tmem192 ablation on lysosomal function and autophagy. Interestingly, loss of Tmem192 does not appear to cause significant global lysosomal dysfunction . Assessment of lysosomal morphology using markers such as Cathepsin D, LAMP-2, and LBPA showed that size and intracellular distribution of lysosomes in Tmem192-deficient cells were comparable to wild-type cells .

Moreover, the specific activity of the lysosomal enzyme β-hexosaminidase was not altered in Tmem192 knockout MEFs, further excluding any relevant global lysosomal dysfunction . Regarding autophagy, basal LC3-II/I ratios were similar in wild-type and Tmem192-deficient MEFs, and no accumulation of p62 (which would indicate impaired autophagy) was observed .

Analysis of the autophagic flux under both basal conditions and starvation-induced autophagy, with and without lysosomal inhibition by Bafilomycin A1, revealed no significant differences . These findings suggest that fusion of autophagosomes and lysosomes is not compromised upon Tmem192 deficiency. Additionally, the activity of the autophagy-regulating kinase mTORC1, assessed by phosphorylation of its target p70 S6 kinase, showed comparable patterns of activation and inactivation in response to nutrient availability in both wild-type and Tmem192-deficient cells .

What is known about the proteolytic processing of Tmem192?

Proteolytic processing of Tmem192 represents an intriguing aspect of its biology with tissue-specific variations. Western blot analyses have revealed the presence of a smaller N-terminal fragment (NTF) of approximately 17 kDa in addition to the full-length protein . This fragment, detected by an antibody against the N-terminal domain of Tmem192, shows a distinct tissue distribution pattern, being prominently observed in most tissues except liver, where it is present only in marginal amounts .

Quantification of the abundance of this Tmem192 fragment relative to the full-length protein across various tissues demonstrated reproducibility of the extent of NTF generation in different organs . In some tissues, particularly bone marrow and thymus, an additional band at around 20-25 kDa has been observed . The proteolytic processing appears to be cell-type specific, with different cell lines showing varying levels of the NTF.

Experiments with protease inhibitors targeting different classes of proteases (serine, cysteine, aspartyl, and metalloproteases) did not prevent generation of the NTF, although some inhibitors slightly altered its electrophoretic migration . Interestingly, interfering with lysosomal acidification using Bafilomycin A1 or ammonium chloride had effects on the processing, suggesting involvement of the lysosomal compartment in this proteolytic event . The functional significance of this processing remains to be fully elucidated, but its tissue-specific nature suggests potential regulatory roles tailored to different cellular contexts.

What experimental models are available for studying Tmem192 function?

Several experimental models have been developed for investigating Tmem192 function, providing complementary approaches for understanding its roles in different contexts. Genetically modified mouse models, including TMEM192-deficient mice generated using targeted embryonic stem cells from the EUCOMM consortium, offer valuable in vivo systems . These models typically involve deletion of critical exons (such as exon 3) to create knockout alleles.

For cellular studies, TMEM192-knockout cell lines derived from various tissues provide important tools for biochemical and functional analyses. These include mouse embryonic fibroblasts (MEFs) from TMEM192-deficient mice, which have been instrumental in studying the impact of TMEM192 deficiency on lysosomal function and autophagy .

Overexpression systems using transfected human or murine TMEM192 in cell lines such as HeLa cells allow for structure-function studies, including investigation of mutated forms of the protein . For tissue-specific expression analysis, mouse models carrying a lacZ reporter allele enable detailed visualization of TMEM192 expression patterns in different organs and cell types .

These diverse experimental systems collectively enable comprehensive investigation of TMEM192's molecular functions, tissue-specific roles, and potential involvement in disease processes.

What are the optimal antibodies and detection methods for Tmem192 research?

Selecting appropriate antibodies and detection methods is critical for successful Tmem192 research, with several commercial and custom options available for different applications. For Western blotting, polyclonal antibodies such as the rabbit polyclonal antibody against Tmem192 (e.g., Boster Bio Anti-Transmembrane protein 192 TMEM192 Antibody, A11938) can effectively detect the protein in human, mouse, and rat samples . Monoclonal antibodies like the rabbit recombinant monoclonal TMEM192 antibody (Abcam, EPR14330) offer high specificity for human Tmem192 .

When selecting antibodies, researchers should consider the epitope location, as antibodies targeting different regions (e.g., N-terminal versus C-terminal) may yield different results, particularly when studying proteolytic fragments . For immunofluorescence microscopy, antibodies validated for this application should be chosen, with special attention to fixation and permeabilization protocols that preserve membrane protein epitopes .

When troubleshooting detection issues, researchers should consider species cross-reactivity limitations, as antibodies raised against human Tmem192 may not recognize the murine orthologue despite the 78% sequence identity . Additionally, optimizing protein extraction protocols is crucial, with particular attention to detergent selection for solubilizing membrane proteins effectively while preserving their native conformation.

How can researchers effectively generate and validate Tmem192 knockout models?

Generating and validating Tmem192 knockout models requires careful strategic planning and comprehensive validation to ensure complete ablation of protein function. For mouse models, approaches such as utilizing embryonic stem cells from consortia like EUCOMM with targeted mutations in the Tmem192 gene provide an established starting point . These can be further modified using Flp-FRT and Cre-loxP systems to generate conditional or constitutive knockout alleles.

Thorough validation at multiple levels is essential: genotyping PCR to confirm the intended genetic modification; RT-PCR and qPCR to verify absence of Tmem192 mRNA; and Western blotting using antibodies targeting different epitopes to confirm complete absence of the protein . Immunofluorescence microscopy provides additional confirmation by demonstrating loss of Tmem192 immunoreactivity in its normal lysosomal localization.

Functional validation should include assessment of known Tmem192-associated processes, though current evidence suggests that Tmem192 deficiency does not significantly impact global lysosomal function or autophagy in MEFs . When interpreting phenotypes, researchers should be alert to potential compensatory mechanisms that may mask the effects of Tmem192 loss, particularly in constitutive knockout models.

For more targeted studies, inducible knockout systems can help distinguish between acute and chronic effects of Tmem192 deficiency, while tissue-specific knockout models can address its role in specific physiological contexts.

What considerations should be made when analyzing Tmem192 in different tissue types?

Analyzing Tmem192 across different tissue types necessitates tailored approaches that account for tissue-specific expression patterns, processing events, and potential functional variations. Given the observed differences in Tmem192 expression levels across tissues (highest in bone marrow, thymus, spleen, kidney, and brain; lower in spinal cord, liver, lung, and sciatic nerve), sample preparation methods should be optimized for each tissue type .

When comparing Tmem192 across tissues, researchers should normalize to appropriate housekeeping proteins that show consistent expression in the tissues being compared. The tissue-specific variation in proteolytic processing of Tmem192, particularly the generation of the 17 kDa N-terminal fragment (NTF) that is prominent in most tissues but minimal in liver, requires careful analysis using antibodies that can detect both full-length protein and fragments .

For tissue-specific expression patterns, immunohistochemistry with validated antibodies or utilizing reporter systems like lacZ in genetically modified mice can provide detailed localization information within complex tissues . In functional studies, researchers should consider that Tmem192's role may vary with the specialized functions of different cell types, particularly in tissues with high lysosomal activity such as liver, immune cells, or neurons.

Finally, when using cell lines as models, their characteristics should be compared to the primary tissues they're intended to represent, as immortalized cell lines often show altered Tmem192 processing patterns compared to primary tissues .

How can researchers assess Tmem192's role in autophagy and lysosomal function?

Investigating Tmem192's potential contributions to autophagy and lysosomal function requires a comprehensive experimental approach that examines multiple aspects of these complex cellular processes. To assess basic lysosomal properties, researchers should evaluate lysosomal morphology and distribution using markers such as LAMP-2, Cathepsin D, and LBPA by immunofluorescence microscopy in wild-type versus Tmem192-deficient systems .

Lysosomal enzyme assays, such as measuring β-hexosaminidase activity in cellular lysates, provide quantitative assessment of global lysosomal function . For autophagy analysis, Western blotting for LC3 conversion (LC3-I to LC3-II ratio) and levels of the autophagic substrate p62/SQSTM1 under both basal and stimulated conditions offers insight into autophagic activity .

Importantly, autophagic flux should be measured by comparing conditions with and without lysosomal inhibitors such as Bafilomycin A1, which prevents degradation of autophagosomes . Co-localization analysis of autophagosomal (LC3) and lysosomal (LAMP-2) markers can reveal potential defects in autophagosome-lysosome fusion.

To examine regulatory pathways, analysis of mTORC1 activity through phosphorylation of targets like p70 S6 kinase under different nutrient conditions can uncover potential roles in nutrient sensing . Despite previous studies suggesting that Tmem192 deficiency does not significantly impact these processes in MEFs, tissue-specific or context-dependent roles remain possible and warrant investigation in different experimental systems.

How should researchers interpret discrepancies in Tmem192 molecular weight observations?

Discrepancies in observed molecular weights for Tmem192 represent a common challenge in the field that requires careful analysis and interpretation. While the calculated molecular weight of Tmem192 based on its amino acid sequence is approximately 31 kDa, Western blot analyses often reveal bands at different apparent molecular weights, ranging from 35 kDa to as high as 68 kDa . Additionally, N-terminal fragments (NTFs) of approximately 17 kDa are consistently observed across most tissues .

These variations can stem from multiple factors that researchers should systematically consider. Post-translational modifications, particularly N-glycosylation at consensus sites (such as N85YT in murine Tmem192), can significantly alter electrophoretic mobility . Researchers can address this by treating samples with glycosidases before Western blotting to determine if size discrepancies resolve with deglycosylation.

Disulfide bond formation, especially relevant for human Tmem192 which forms homodimers through disulfide bridges, can be assessed by comparing reducing versus non-reducing conditions in Western blotting . Membrane protein solubilization methods, including detergent selection and sample heating conditions, can affect observed molecular weights by influencing protein conformations.

Tissue-specific processing events generate the 17 kDa NTF and potentially other fragments, requiring antibodies targeting different epitopes to comprehensively map these products . Different antibodies may recognize distinct conformational epitopes or be differentially affected by post-translational modifications, explaining why different antibodies may reveal different banding patterns for the same protein.

What are the key considerations when analyzing Tmem192 in co-localization studies?

Co-localization studies involving Tmem192 require meticulous technical execution and careful interpretation to yield meaningful insights into its subcellular distribution and potential functional interactions. Selection of appropriate markers for co-localization is critical, with late endosomal/lysosomal proteins such as LAMP-2 and late endosomal/lysosomal lipids like LBPA (lysobisphosphatidic acid) being particularly relevant . For autophagy studies, markers such as LC3 can reveal potential associations with autophagosomes.

Fixation and permeabilization protocols significantly impact membrane protein detection and should be optimized specifically for Tmem192, with glutaraldehyde fixation sometimes preserving membrane protein epitopes better than formaldehyde alone. Antibody validation is essential, particularly confirming specificity through knockout controls, as demonstrated in studies using TMEM192-deficient mice where specific immunoreactivity was absent .

High-resolution imaging techniques such as confocal microscopy or super-resolution approaches provide the necessary resolution to accurately assess co-localization of membrane proteins in small organelles like lysosomes. For quantitative analysis, researchers should employ established co-localization metrics such as Pearson's correlation coefficient or Manders' overlap coefficient, rather than relying solely on visual assessment.

When interpreting results, it's important to recognize that partial co-localization is common for membrane proteins that cycle between compartments, and complete overlap should not necessarily be expected. Additionally, overexpression systems may alter the natural distribution of Tmem192, so findings should be validated in systems with endogenous expression levels whenever possible .

How can researchers quantitatively assess Tmem192 expression levels across different tissues?

Quantitative assessment of Tmem192 expression across tissues demands rigorous methodological approaches to ensure accurate comparisons despite the complexities of tissue-specific variations. Western blotting with carefully validated antibodies provides a foundation for comparing protein levels, but requires meticulous attention to equal protein loading (verified by consistent housekeeping proteins) and linear range detection .

Densitometric analysis should include both the full-length Tmem192 and its N-terminal fragment (NTF), as their ratios vary significantly between tissues . For mRNA quantification, RT-qPCR using validated primers spanning exon-exon boundaries ensures specificity and allows comparison of transcript levels across tissues.

For spatial resolution within tissues, quantitative immunohistochemistry with digital image analysis or utilizing reporter systems like lacZ in genetically modified mice can reveal cell type-specific expression patterns . Flow cytometry with intracellular staining provides quantitative single-cell analysis of Tmem192 levels in isolated cell populations from different tissues .

When comparing across tissues, normalization strategies should account for differences in cellularity and protein content. Statistical analysis should incorporate biological replicates from multiple individuals to account for inter-individual variability. Finally, researchers should consider physiological or pathological conditions that might influence expression, as Tmem192 levels may dynamically respond to cellular stress, differentiation, or disease states.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.