Recombinant Rat Transmembrane protein 196 (Tmem196)

Shipped with Ice Packs
In Stock

Description

Tumor Suppressor Activity

  • Epigenetic Regulation: Tmem196 is frequently hypermethylated in lung cancer, leading to transcriptional silencing. Demethylation via 5-aza-2′-deoxycytidine restores expression, confirming epigenetic regulation .

  • In Vitro Effects:

    • Overexpression inhibits lung cancer cell proliferation, colony formation, and migration by inducing G2/M cell-cycle arrest and apoptosis .

    • Knockdown increases cell proliferation and reduces apoptosis, highlighting its tumor-suppressive role .

  • In Vivo Validation: Tumors derived from Tmem196-expressing cells are smaller and lighter in murine models (P < 0.01) .

Molecular Mechanisms

  • Pathway Modulation:

    • Upregulates pro-apoptotic Bax and cell-cycle inhibitor p21.

    • Downregulates oncogenic markers (cyclin D1, c-myc, CD44, β-catenin) .

  • Clinical Relevance: Low Tmem196 expression correlates with advanced tumor stage, poor differentiation, and reduced survival in lung cancer patients (HR = 0.51, P < 0.01) .

Applications in Research

  • Biochemical Assays: Used in SDS-PAGE for purity validation and functional studies .

  • Cancer Studies: Critical for investigating methylation-driven tumorigenesis and therapeutic targets in lung cancer .

  • Structural Biology: The His-tagged recombinant protein facilitates interaction studies to map binding partners and signaling pathways .

Key Research Findings

  • Rat Lung Cancer Model: Tmem196 methylation is observed in precancerous and tumor tissues, with loss of protein expression during carcinogenesis .

  • Therapeutic Potential: Re-expression of Tmem196 in cancer cells reduces tumor growth by 30–50%, suggesting its utility in epigenetic therapy .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes, and we will fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery estimates.
Note: All protein shipments are standardly sent with blue ice packs. If dry ice is required, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Tmem196; Transmembrane protein 196
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Tmem196
Target Protein Sequence
MCTSGQIIGSLLVLSVLEIGLGVSSVAVGAVSFSLALREHTPQLGDSSPFLLCGICGILC AKKKSGLVMILFSACCICGLIGGILNFQFLRAVTKKTSSLYPLHLASMSLACIGIGGCTV SSWLTCRLASYEQRRMFSEREHSLHHSHEMAEKEVTDNMSNGAPQLIFNGRVQSMF
Uniprot No.

Target Background

Gene References Into Functions
  1. TMEM196 acts as a novel functional tumor suppressor inactivated by DNA methylation and is an independent prognostic factor of lung cancer PMID: 26056045
Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Tmem196 and what are its basic structural features?

Tmem196 (Transmembrane Protein 196) is predicted to be an integral component of membrane protein in rats. It is orthologous to human TMEM196 and has a molecular weight of approximately 18.85 kDa. The gene spans approximately 63,946 base pairs, contains 5 exons, and produces 6 different transcripts . The protein is identified in UniProt database with the primary accession number Q5EB63, and corresponds to NCBI gene ID 500750 and Ensembl ID ENSRNOG00000037435 . As a transmembrane protein, it contains domains that traverse the cell membrane, with portions exposed to both intracellular and extracellular environments, which is consistent with its predicted function as an integral membrane component.

What are the validated methods for detecting and quantifying Tmem196 in rat samples?

The most commonly validated method for detecting and quantifying Tmem196 in rat samples is Enzyme-Linked Immunosorbent Assay (ELISA). Commercial ELISA kits are available with a detection range of 0.156 ng/ml to 10 ng/ml using a colorimetric detection method . These kits are optimized for native protein detection in tissue homogenates, cell lysates, and other biological fluids . For gene expression analysis, quantitative real-time PCR (qPCR) has been validated for detecting Tmem196 mRNA levels in tissues, particularly in studies comparing expression between different experimental groups . RNA sequencing (RNA-Seq) approaches have also been employed for analyzing differential expression patterns, as demonstrated in compartment-specific analyses such as isolated glomeruli . Immunohistochemistry techniques may be used for tissue localization studies, though specific protocols would need to be optimized based on available antibodies.

What considerations should be taken when working with recombinant versus native Tmem196?

When working with recombinant versus native Tmem196, researchers should consider several important factors. First, detection kits are generally optimized for native Tmem196 rather than recombinant proteins . Commercial providers note that recombinant proteins may have different sequences or tertiary structures compared to the native protein, which can affect detection reliability . For accurate results, sample concentrations should be diluted to the mid-range of the detection kit specifications. If working with recombinant Tmem196, researchers should validate the protein's structural integrity and functional properties compared to native protein. Additionally, expression systems can influence post-translational modifications, which might be critical for the protein's function. Storage conditions for both native and recombinant proteins should follow manufacturer recommendations to maintain stability, typically at 4°C upon receipt, with specific storage instructions provided in kit manuals .

What tissue preparation protocols yield optimal results for Tmem196 detection?

For optimal Tmem196 detection, tissue preparation protocols should be tailored to the specific detection method. For ELISA-based detection, tissue homogenates should be prepared under conditions that preserve protein integrity, typically using appropriate lysis buffers containing protease inhibitors . When isolating specific cellular compartments, such as glomeruli for kidney studies, specialized isolation techniques are required to maintain tissue-specific expression patterns . For RNA-based detection methods, RNA extraction should be performed using protocols that minimize degradation and maintain RNA integrity. In expression studies, it's critical to standardize tissue collection, processing times, and storage conditions across experimental groups to avoid introducing technical variability. Additionally, to minimize performance fluctuations, operation procedures and laboratory conditions should be strictly controlled, and ideally, the same researcher should perform the entire assay procedure .

What is the evidence linking Tmem196 to cancer development in rat models?

Strong evidence links Tmem196 to cancer development in rat models, particularly in lung cancer. Research has demonstrated that TMEM196 methylation correlates with loss of protein expression in chemical-induced rat lung pathologic lesions . This epigenetic silencing mechanism appears to be a significant factor in the development and progression of lung cancer. Treatment with the demethylating agent 5-aza-2′-deoxycytidine restored TMEM196 expression, confirming the role of methylation in regulating this gene . Furthermore, functional studies showed that artificially reintroducing TMEM196 expression in lung cancer cells inhibited cell proliferation and clonogenicity, supporting its role as a tumor suppressor . These findings collectively suggest that loss of Tmem196 function, primarily through promoter hypermethylation, contributes to lung carcinogenesis in rat models by removing constraints on cellular proliferation.

How does Tmem196 expression correlate with disease progression in experimental models?

In experimental disease models, particularly in cancer, Tmem196 expression shows significant correlation with disease progression. In human lung cancer patients, TMEM196 hypermethylation was detected in 61.2% of primary lung tumors and was found to be associated with poor differentiation and advanced pathological stages . This indicates that decreased Tmem196 expression may be a biomarker for disease severity and progression. While the search results don't provide specific temporal expression data throughout disease progression, the association with advanced pathological stages suggests that Tmem196 downregulation may be either a cause or consequence of disease advancement. Further longitudinal studies would be valuable to determine whether Tmem196 expression changes precede pathological manifestations or occur as a result of disease processes, which would clarify its potential as an early diagnostic marker or therapeutic target.

What epigenetic mechanisms regulate Tmem196 expression in normal and pathological states?

DNA methylation has been identified as a primary epigenetic mechanism regulating Tmem196 expression in both normal and pathological states. In lung cancer, hypermethylation of the TMEM196 promoter correlates strongly with silencing of gene expression . Treatment with the demethylating agent 5-aza-2′-deoxycytidine restored TMEM196 expression in affected cells, confirming the causal relationship between methylation and gene silencing . This epigenetic regulation appears to be a critical factor in the development and progression of cancer, with TMEM196 hypermethylation detected in 61.2% of primary lung tumors . The mechanism likely involves recruitment of methyl-CpG-binding proteins and subsequent chromatin remodeling that renders the promoter inaccessible to transcription factors. While the search results focus primarily on methylation, other epigenetic mechanisms such as histone modifications and non-coding RNAs might also contribute to Tmem196 regulation, though these would require further investigation to elucidate their specific roles.

How do genetic variations in Tmem196 affect its function and disease susceptibility?

Genetic variations in Tmem196 can potentially affect its function and disease susceptibility, though detailed information on specific variants is limited in the available search results. Theoretical analyses based on related transmembrane proteins suggest that non-synonymous mutations, particularly in transmembrane domains or functional motifs, could alter protein folding, trafficking, or interactions with binding partners. The PROVEAN score method, which has been used to identify potentially deleterious non-synonymous variants in related genes , could be applied to Tmem196 variants to predict their functional impact. Variations affecting promoter regions could influence transcriptional regulation, while those in splice sites might alter mRNA processing and isoform expression. In disease contexts, particularly cancer, somatic mutations might compound the effects of epigenetic silencing, leading to complete loss of tumor-suppressive function. Further research using genome-wide association studies or targeted sequencing of Tmem196 in disease cohorts would be valuable to identify specific variants associated with disease susceptibility.

What are the challenges in studying Tmem196 promoter regulation and gene expression?

Studying Tmem196 promoter regulation and gene expression presents several technical and biological challenges. First, the complex nature of epigenetic regulation requires sophisticated techniques to comprehensively analyze DNA methylation patterns, histone modifications, and chromatin structure at the Tmem196 locus. Second, tissue-specific and context-dependent expression patterns necessitate careful selection of experimental models and conditions that accurately reflect physiological or pathological states of interest. Third, the presence of multiple transcripts (six have been identified in rats ) complicates expression analysis, requiring isoform-specific detection methods to distinguish functionally distinct variants. Fourth, low basal expression levels in certain tissues may challenge detection limits of standard techniques, requiring highly sensitive methods. Fifth, the lack of well-characterized antibodies specifically validated for rat Tmem196 may limit protein-level studies. Finally, translating findings between species requires careful consideration of evolutionary differences in regulatory elements and expression patterns. Overcoming these challenges requires integrated approaches combining genomic, epigenomic, transcriptomic, and proteomic methodologies to fully elucidate Tmem196 regulation.

What cell-type specific expression patterns of Tmem196 have been documented in rat tissues?

While comprehensive cell-type specific expression patterns of Tmem196 across rat tissues are not fully documented in the provided search results, some tissue-specific information can be inferred. Research focusing on lung tissues has identified Tmem196 expression in normal lung cells, with decreased expression in cancerous tissues due to promoter hypermethylation . The availability of compartment-specific RNA sequencing techniques, as mentioned in result regarding isolated glomeruli, suggests that methodologies exist to analyze Tmem196 expression in specific cell populations. Based on its predicted function as a transmembrane protein and its potential role as a tumor suppressor, Tmem196 is likely expressed in epithelial cell types across multiple tissues. Further research using single-cell RNA sequencing, immunohistochemistry with cell-type specific markers, or fluorescence-activated cell sorting followed by expression analysis would be valuable to create a comprehensive atlas of Tmem196 expression across cell types in various rat tissues, which would provide insights into its tissue-specific functions.

How can CRISPR/Cas9 technology be optimized for studying Tmem196 function?

CRISPR/Cas9 technology offers powerful approaches for studying Tmem196 function through various genomic editing strategies. For gene knockout studies, guide RNAs (gRNAs) should be designed targeting early exons or critical functional domains of Tmem196 to ensure complete loss of function. Multiple gRNAs can be tested to identify those with highest editing efficiency and specificity. For knock-in studies, such as introducing fluorescent tags or specific mutations, homology-directed repair templates should be designed with sufficiently long homology arms (typically 500-1000bp) flanking the desired modification. To study promoter regulation, CRISPR interference (CRISPRi) with catalytically inactive Cas9 fused to transcriptional repressors can target the Tmem196 promoter region, while CRISPR activation (CRISPRa) with transcriptional activators can be used to upregulate expression. Cell type-specific promoters driving Cas9 expression can enable tissue-specific Tmem196 manipulation in vivo. For epigenetic studies, Cas9 fused to DNA methyltransferases or demethylases can directly modify methylation status at the Tmem196 promoter to evaluate causality in gene silencing. Validation of editing efficiency should include genomic PCR, sequencing, mRNA quantification, and protein detection methods.

What interactome studies would advance understanding of Tmem196 biological functions?

Advanced interactome studies would significantly enhance our understanding of Tmem196 biological functions by identifying its protein-protein interaction network and associated molecular pathways. Proximity labeling approaches such as BioID or APEX2, where Tmem196 is fused to a biotin ligase, would enable identification of proximal proteins in living cells, particularly valuable for transmembrane proteins where traditional pull-down approaches may disrupt membrane-associated complexes. Co-immunoprecipitation followed by mass spectrometry (IP-MS) using epitope-tagged Tmem196 could identify stable interaction partners, while crosslinking IP-MS could capture transient interactions. Yeast two-hybrid or mammalian two-hybrid screens could identify direct binding partners. For functional pathway analysis, genetic interaction screens using CRISPR libraries could identify synthetic lethal interactions that reveal functional relationships. Phosphoproteomics and other post-translational modification analyses would help place Tmem196 within signaling cascades. Integration of these data with transcriptomics from Tmem196 knockdown or overexpression studies would create a comprehensive view of the pathways it influences. These approaches would be particularly valuable given Tmem196's potential tumor suppressor function, potentially revealing novel mechanisms of growth regulation and identifying new therapeutic targets in cancer.

What expression systems yield functional recombinant rat Tmem196?

While the search results don't provide specific information about expression systems for recombinant rat Tmem196, general principles for transmembrane protein expression can be applied. Mammalian expression systems such as HEK293 or CHO cells would likely yield the most functionally relevant Tmem196 protein due to appropriate post-translational modifications and membrane insertion machinery. These systems can be transiently transfected with expression vectors containing the Tmem196 coding sequence under a strong promoter like CMV, or stable cell lines can be generated for consistent production. For structural studies requiring higher yields, insect cell systems like Sf9 or High Five cells using baculovirus vectors may be appropriate. Bacterial systems like E. coli are generally less suitable for transmembrane proteins due to differences in membrane composition and lack of post-translational modification machinery, though specialized strains and protocols exist. Yeast systems like Pichia pastoris represent an intermediate option that may balance yield with proper protein folding. The choice of expression system should consider the intended application, required yield, and importance of post-translational modifications for Tmem196 function.

What purification strategies are effective for maintaining Tmem196 stability and function?

Effective purification strategies for transmembrane proteins like Tmem196 must balance efficient extraction from membranes with maintenance of protein stability and function. The purification process should begin with careful cell lysis using methods that preserve membrane integrity, followed by membrane isolation through differential centrifugation. For extraction, mild detergents such as n-dodecyl-β-D-maltoside (DDM), digitonin, or CHAPS are typically more effective than harsh detergents like Triton X-100 or SDS, which may denature the protein. Affinity chromatography using tags such as His6, FLAG, or Strep-tag II engineered into the recombinant protein provides specific capture while minimizing non-specific binding. Size exclusion chromatography can further separate monomeric protein from aggregates. Throughout purification, protein stability should be maintained by including appropriate protease inhibitors, working at 4°C, and using buffers that mimic physiological pH and salt concentrations. For long-term storage or structural studies, reconstitution into nanodiscs, liposomes, or amphipols may better maintain native conformation than detergent micelles. Functional assays should be established to verify that the purified protein retains its biological activity, which is essential for downstream applications.

Table 1: Comparative Properties of Rat Tmem196

PropertyDetailsReference
Gene SymbolTMEM196
UniProt IDQ5EB63
NCBI Gene ID500750
Ensembl IDENSRNOG00000037435
Gene Length63,946 bp
Molecular Weight18.85 kDa
Number of Transcripts6
Number of Exons5
Cellular LocalizationIntegral component of membrane (predicted)
ELISA Detection Range0.156 ng/ml - 10 ng/ml
Methylation in Lung CancerDetected in 61.2% of primary tumors

Table 2: Recommended Methodological Approaches for Tmem196 Research

Research ObjectiveRecommended MethodsKey Considerations
Protein DetectionELISA (colorimetric)Optimal for tissue homogenates, cell lysates; sample concentrations should be diluted to mid-range of kit
Expression AnalysisqPCR, RNA-SeqCompartment-specific analysis improves resolution
Methylation AnalysisBisulfite sequencing, Methylation-specific PCRCritical for analyzing epigenetic regulation in cancer
Functional AnalysisEctopic expression, Gene knockdownEssential for determining tumor suppressor activity
Restoration of ExpressionTreatment with demethylating agents (e.g., 5-aza-2′-deoxycytidine)Confirms methylation as regulatory mechanism

What are the major knowledge gaps in understanding Tmem196 biology?

Despite progress in Tmem196 research, significant knowledge gaps remain. First, the precise molecular function of Tmem196 is poorly understood—while evidence suggests it acts as a tumor suppressor , the specific molecular mechanisms and pathways through which it regulates cell growth remain uncharacterized. Second, the protein's structural features, particularly its transmembrane topology and functional domains, need detailed elucidation. Third, understanding of tissue-specific and developmental expression patterns is incomplete, limiting insights into its physiological roles. Fourth, the signaling pathways and interacting partners of Tmem196 remain largely unknown, hindering placement within cellular regulatory networks. Fifth, while epigenetic silencing through methylation has been documented in cancer , other regulatory mechanisms controlling Tmem196 expression in normal and pathological states require investigation. Finally, the evolutionary conservation of Tmem196 function across species needs verification through comparative studies. Addressing these knowledge gaps would significantly advance understanding of Tmem196 biology and its potential applications in disease diagnosis and treatment.

How might single-cell technologies advance Tmem196 research?

Single-cell technologies offer transformative potential for advancing Tmem196 research by providing unprecedented resolution of its expression patterns and functional roles across heterogeneous cell populations. Single-cell RNA sequencing (scRNA-seq) would enable detailed mapping of Tmem196 expression across cell types and states, revealing previously undetected patterns and potential functional associations. This approach could identify rare cell populations with distinctive Tmem196 expression that might be masked in bulk tissue analyses. Single-cell ATAC-seq could characterize the chromatin accessibility at the Tmem196 locus across cell types, providing insights into its transcriptional regulation. Single-cell epigenomics techniques, including methylation profiling, would allow correlation between Tmem196 expression and its epigenetic state at individual cell resolution, particularly valuable given its known regulation by methylation in cancer . Spatial transcriptomics would add contextual information by preserving tissue architecture, showing how Tmem196 expression relates to specific microenvironments. Finally, multimodal single-cell approaches combining these technologies would create integrated maps connecting Tmem196 expression to epigenetic state, cellular identity, and spatial context, providing holistic understanding of its biology in normal development and disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.