Recombinant Rat Transmembrane protein 199 (Tmem199)

Shipped with Ice Packs
In Stock

Description

Introduction

Transmembrane protein 199 (Tmem199) is a protein encoded by the TMEM199 gene, playing diverse roles in cellular function and disease, dependent on the organism. Research indicates its involvement in Golgi homeostasis, tumor immunology, and congenital disorders of glycosylation . Studies of Tmem199 have been conducted on rat models, as well as humans.

Gene and Protein Structure

The TMEM199 gene, located on chromosome 17 (GRCh37/hg19: chr17:26,684,687–26,689,089), comprises six exons and encodes a 208 amino acid protein . The protein includes a conserved Vma12 domain at the C terminus, found widely among eukaryotes, including Arabidopsis thaliana . The Vma12 domain contains two transmembrane helices .

Tissue Expression and Subcellular Localization

Rat Tmem199 has been found to surround the nuclear membrane, with some distribution in the cytoplasm, displaying similarity to proteins that target the endoplasmic reticulum .

Functional Roles

  • Golgi Homeostasis: Tmem199 is essential for maintaining normal Golgi function .

  • Tumor Immunology: Nuclear-located TMEM199 regulates CD274 mRNA expression by transcriptional regulation of upstream transcription factors or cofactors of CD274, such as IFNGR1, IRF1, MTMR9, KAT8, and Trim28 . TMEM199 does not affect cancer cell proliferation and invasion in a single tumor cell environment but influences the tumor immune microenvironment, consequently mediating the tumor bulk size .

  • Spermatogenesis: TMEM225 (a different protein) may play a role in sperm degeneration but not in spermatogenesis .

Role in Disease

  • TMEM199-Congenital Disorder of Glycosylation (CDG): TMEM199-CDG is a rare autosomal recessive inherited disease characterized by chronically elevated serum transaminase, decreased serum ceruloplasmin, and steatosis .

  • TMEM199 Deficiency: Individuals with TMEM199 mutations may show mild clinical presentations, including hypercholesterolemia, elevated low-density lipoprotein cholesterol (LDL-C), elevated alkaline phosphatase (ALP, bone-derived), and elevated aminotransferases (ATs, consisting of aspartate aminotransferase [AST] and alanine aminotransferase [ALT]) . Liver biopsy can show lipid degeneration and mild steatosis with minimal fibrosis, as well as slight abnormalities of copper metabolism .

Impact on Tumor Microenvironment

TMEM199 mediates the immune microenvironment; TMEM199 correlates with cancer immune infiltration . Knockdown of TMEM199 influences immune checkpoints, with CD274 and CD276 expression levels reduced and CD70, IDO1, BTN2A1, and other immune checkpoints upregulated .

Recombinant Expression

A low-cost and high-throughput recombinant expression platform can characterize the role of transmembrane protein hTMEM205 in Pt(II)-drug resistance and extrusion . The sole presence of TMEM205 in the membrane is sufficient to counteract the toxic effect of cisplatin, and the protective effect might arise from cisplatin binding/sequestration or from direct hTMEM205-mediated extrusion across the lipid bilayer .

Genetic Variants

Genetic variants of TMEM199 have been identified and classified based on pathogenicity . Prediction programs can assess whether missense mutations are pathogenic .

Tables

Table 1: Pathogenicity Prediction of Missense Mutations in TMEM199

MutationPrediction Program 1Prediction Program 2Prediction Program 3
c.92G>CPathogenicBenignLikely Pathogenic
c.215A>TPathogenicPathogenicPathogenic
c.503C>TBenignLikely BenignBenign

Table 2: TMEM199 and Immune Cell Correlation

Immune Cell TypeCorrelation with TMEM199
CD8+ T cellsPositive
CD4+ T cellsNegative
CD11b+ cellsPositive

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
Tmem199; Transmembrane protein 199
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-208
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Tmem199
Target Protein Sequence
MASSLLAGERLVRALDPGGELEREQLPRKLRAQLEAALGKKHAGSDNATGPRRLVSFRLI RDLHQHLRERNSMLYLHELLEGSEIYFPEIVKPPRNPELVARLEKIKIQLANEEYKRITR NVTCQDAQCGGTLSDLGKQVRSVKALVITIFNFIVTVAAAFVCTYLGSQYIFTEMASRVL AALIVASVVGLAELYVMVRAMEGELGEL
Uniprot No.

Target Background

Function
Recombinant Rat Transmembrane protein 199 (Tmem199) is an accessory component of the vacuolar (V)-ATPase proton pump, playing a crucial role in intracellular iron homeostasis. Under aerobic conditions, it is essential for maintaining intracellular iron balance. This function triggers Fe(2+) prolyl hydroxylase (PHD) enzyme activity, leading to HIF1A hydroxylation and subsequent proteasomal degradation. Tmem199 is also necessary for endolysosomal acidification and lysosomal degradation and may be involved in Golgi homeostasis.
Database Links
Subcellular Location
Cytoplasmic vesicle, COPI-coated vesicle membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What are the known cellular localizations of TMEM199 and their significance?

TMEM199 exhibits a complex localization pattern that includes both cytoplasmic and nuclear presence. While the majority of TMEM199 is expressed in the cytoplasm, a significant portion can translocate to the nucleus where it performs distinct regulatory functions . This dual localization pattern suggests that TMEM199 may serve as a signaling intermediary between different cellular compartments. The nuclear localization of TMEM199 has been verified through multiple experimental methods in both fixed cells and live cells . This dual localization is significant because it relates to TMEM199's divergent functions - nuclear TMEM199 is involved in transcriptional regulation of immune checkpoint molecules, while cytoplasmic TMEM199 appears to be involved in glycosylation pathways and potentially lysosomal function .

How does TMEM199 differ across species, and what experimental considerations should be made when using rat models?

The available research doesn't provide specific information about the conservation of TMEM199 between rat and human models. When working with recombinant Rat TMEM199, researchers should consider:

  • Perform sequence alignment analysis to determine the level of homology between rat and human TMEM199

  • Validate antibodies for cross-reactivity when using antibodies developed against human TMEM199 for rat studies

  • Conduct pilot studies to confirm that functional properties observed in rat TMEM199 translate to human systems

  • Consider domain-specific conservation, as functional domains may be more highly conserved than non-functional regions

These considerations are crucial for ensuring that findings from rat models can be appropriately translated to human biology.

What are the recommended methods for detecting endogenous TMEM199 in rat tissue samples?

Based on current research methodologies, several approaches can be recommended for detecting endogenous TMEM199 in rat tissue samples:

  • Immunohistochemistry (IHC): This has been successfully used to detect reduced expression of TMEM199 in clinical samples

  • Western Blotting: Standard approach for detecting and quantifying TMEM199 protein levels in tissue lysates

  • Immunofluorescence: Particularly useful for subcellular localization studies to visualize the distribution of TMEM199 between nuclear and cytoplasmic compartments

  • RT-qPCR: For measuring TMEM199 mRNA expression levels in different tissues or under various experimental conditions

When performing these methods, it's crucial to use validated antibodies that specifically recognize rat TMEM199 and to include appropriate positive and negative controls.

What approaches are most effective for studying TMEM199 nuclear localization and function?

Several approaches have proven effective for studying TMEM199 nuclear localization and function:

  • Cell Fractionation and Western Blotting:

    • Separate nuclear, cytoplasmic, and membrane fractions

    • Analyze TMEM199 distribution across fractions

    • Include compartment-specific markers as controls

  • Confocal Immunofluorescence Microscopy:

    • Use specific antibodies against TMEM199

    • Co-stain with nuclear markers (e.g., DAPI)

    • Perform z-stack imaging to confirm nuclear localization

  • Cut&Tag Assay:

    • Used successfully to explore nuclear-located TMEM199 functions

    • Identifies genome-wide binding profiles

    • Can be combined with RNA-seq to correlate binding with gene expression

  • Chromatin Immunoprecipitation (ChIP):

    • The ChIP-qPCR assay has been used to verify TMEM199 binding to specific gene promoter regions

    • Helps confirm direct interactions with regulatory DNA elements

These methods have successfully revealed TMEM199's role in transcriptional regulation of genes involved in immune responses .

How can Cut&Tag assays be optimized for studying TMEM199 chromatin interactions?

Based on published research using Cut&Tag assays for TMEM199, several optimization strategies can be recommended:

  • Antibody Selection:

    • Use highly specific antibodies against TMEM199 validated for immunoprecipitation

    • Consider tagged versions of TMEM199 (e.g., FLAG-tagged) if antibody quality is a concern

  • Experimental Design:

    • Include positive controls (regions expected to be bound by TMEM199 based on ChIP-qPCR data)

    • Test different cross-linking conditions to capture both direct and indirect DNA associations

    • Select cell types where TMEM199 shows clear nuclear localization

  • Data Analysis:

    • Integrate Cut&Tag data with RNA-seq data to correlate binding with gene expression changes

    • Perform de novo motif analysis to identify transcription factor binding motifs enriched at TMEM199 binding sites

    • Use cumulative distribution analysis to determine activating or repressive functions

  • Validation:

    • Confirm key binding sites with orthogonal methods such as ChIP-qPCR

    • Perform functional validation through gene expression analysis following TMEM199 manipulation

This approach has successfully identified TMEM199 binding to immune-regulatory genes and revealed its association with FOX transcription factor binding motifs .

What is the role of TMEM199 in cancer immune escape mechanisms?

Research has revealed several key aspects of TMEM199's role in cancer immune escape mechanisms:

  • PD-L1 Regulation:

    • Nuclear-located TMEM199 regulates PD-L1 (CD274) mRNA levels by binding to transcription factors such as IFNGR1, IRF1, MTMR9, and Trim28

    • Knockdown of TMEM199 decreases PD-L1 expression at both mRNA and protein levels

    • Flow cytometry analysis confirms decreased cell surface expression of PD-L1 in TMEM199 knockdown cells

  • Immune Checkpoint Modulation:

    • TMEM199 knockout cells show an altered profile of immune checkpoints:

      • Decreased CD274 (PD-L1) and CD276

      • Increased expression of CD70, IDO1, BTN2A1, and other immune checkpoints

  • Tumor Microenvironment Impact:

    • TMEM199 expression correlates with cancer immune cell infiltration

    • Tumors with TMEM199 knockdown show significantly reduced growth in the context of an immune microenvironment, though TMEM199 doesn't directly affect cancer cell proliferation or invasion in isolation

This evidence supports TMEM199's role as a "baton of immune microenvironment regulation" with significant implications for cancer immunotherapy strategies .

How do mutations in TMEM199 contribute to congenital disorders of glycosylation?

TMEM199-congenital disorder of glycosylation (TMEM199-CDG) is a rare autosomal recessive inherited disease characterized by specific clinical features:

  • Clinical Manifestations:

    • Chronically elevated serum transaminases

    • Decreased serum ceruloplasmin and copper levels

    • Steatosis and/or fibrosis, potentially progressing to cirrhosis

    • Abnormal protein glycosylation

    • Additional features may include strabismus, hypercholesterolemia, elevated alkaline phosphatase, and coagulopathy

  • Genetic Basis:

    • Pathogenic variants in the TMEM199 gene lead to reduced levels of TMEM199 protein

    • A frameshift variant (c.128delA/p.Lys43Argfs*25) has been reported in the TMEM199 gene, likely resulting in a truncated, non-functional protein

  • Molecular Mechanisms:

    • While the specific mechanisms aren't fully elucidated in the available research, the glycosylation defects likely result from disruption of TMEM199's role in cellular protein processing pathways

    • TMEM199's involvement in lysosomal function may contribute to the pathogenesis of CDG

Understanding these mechanisms could lead to potential therapeutic strategies for patients with TMEM199-CDG.

What is the molecular mechanism by which TMEM199 regulates PD-L1 expression?

Research has revealed a complex molecular mechanism by which TMEM199 regulates PD-L1 (CD274) expression:

  • Transcriptional Regulation:

    • Nuclear-located TMEM199 binds to the gene promoter sites of multiple transcription factors that regulate PD-L1, including IFNGR1, IRF1, MTMR9, KAT8, and Trim28

    • TMEM199 acts as a transcriptional co-factor rather than directly binding DNA

    • De novo motif analysis revealed that TMEM199 binding sites are enriched for forkhead box (FOX) protein binding motifs, suggesting TMEM199 may attach to FOX proteins and adhere to their DNA binding sites

  • Functional Validation:

    • Knockdown of TMEM199 significantly decreases CD274 mRNA expression

    • Overexpression of TMEM199 reverses this effect and increases CD274 mRNA levels

    • Knockdown of the transcription factors IFNGR1, IRF1, c-Jun, KAT8, or Trim28 decreases CD274 mRNA levels, similar to the effect of TMEM199 knockdown

  • Protein Level Effects:

    • TMEM199 knockdown also decreases PD-L1 protein levels in multiple cancer cell lines

    • Flow cytometry analysis confirms decreased cell surface expression of PD-L1

    • No direct interaction between TMEM199 and PD-L1 proteins was detected, confirming regulation occurs at the transcriptional level

This mechanism establishes TMEM199 as a novel transcriptional regulator of PD-L1 with potential implications for cancer immunotherapy.

How can researchers differentiate between the functions of cytoplasmic versus nuclear TMEM199?

Differentiating between compartment-specific functions of TMEM199 requires specialized experimental approaches:

ApproachMethodologyExpected Outcome
Domain MappingCreate truncation mutants to identify nuclear localization domainsIdentification of specific regions required for nuclear versus cytoplasmic functions
Compartment-Restricted ExpressionGenerate TMEM199 constructs with added nuclear localization signals (NLS) or nuclear export signals (NES)Clear separation of nuclear and cytoplasmic functions
Interaction Partner AnalysisPerform compartment-specific immunoprecipitation followed by mass spectrometryIdentification of distinct interactors in each compartment
Functional ReadoutsMeasure transcriptional changes (nuclear) versus glycosylation/lysosomal functions (cytoplasmic)Correlation of specific functions with localization
Selective InhibitionTest whether inhibitors like omeprazole differentially affect nuclear versus cytoplasmic functionsPotential for targeted intervention in specific compartments

These approaches would help build a comprehensive understanding of how TMEM199 functions differently depending on its subcellular localization, which appears to be a key aspect of its biological roles .

What are the current hypotheses regarding TMEM199 nuclear translocation mechanisms?

While the exact mechanisms of TMEM199 nuclear translocation remain to be fully elucidated, current research points to several possibilities:

  • Active Transport Mechanisms:

    • The research notes that TMEM199 may use "the machinery for the nuclear translocation of cytosolic proteins" similar to how other transmembrane proteins enter the nucleus

    • This suggests involvement of importin-dependent pathways that recognize nuclear localization signals

  • Domain-Specific Targeting:

    • Researchers have "analyzed the truncated fractions that mediate its nuclear localization," indicating specific domains are responsible for nuclear targeting

    • These domains likely contain sequence motifs recognized by the nuclear import machinery

  • Potential Mechanisms Based on Other Transmembrane Proteins:

    • The research mentions that Tspan8, a 4-pass transmembrane protein, has been shown to translocate to the nucleus, suggesting similar mechanisms might apply to TMEM199

    • Approximately 10% of eukaryotic transmembrane proteins localize to the nuclear membrane, though specific translocation mechanisms "remain in dispute"

The researchers note that "the mechanism of its nuclear targeting is worthy of attention," highlighting this as an important area for future investigation .

How does TMEM199 interact with the FOX family of transcription factors in gene regulation?

The interaction between TMEM199 and FOX family transcription factors represents a key aspect of its gene regulatory function:

  • Binding Site Analysis:

    • De novo motif analysis of TMEM199 binding sites revealed enrichment of forkhead box (FOX) protein binding motifs, including FoxM1, FoxI1, FoxK, Foxb1, and FoxL2

    • This suggests TMEM199 preferentially associates with genomic regions bound by these transcription factors

  • Protein Interaction Evidence:

    • IP-MS assay analysis of interacting nuclear proteins suggested that FOX proteins can interact with TMEM199

    • Researchers inferred that "TMEM199 attaches to the FOX protein and adheres to the gene binding site of the FOX proteins"

  • Functional Significance:

    • FOX transcription factors regulate several biological processes including metabolic reprogramming, inflammatory responses, aging, and autophagy

    • They are also involved in cancer initiation, progression, and chemotherapeutic drug resistance

    • TMEM199's interaction with these factors may explain its role in regulating immune response genes

  • Regulatory Mechanisms:

    • TMEM199 likely functions as a co-factor that modulates FOX-dependent transcription

    • This co-factor role may involve recruiting additional regulatory proteins or affecting chromatin accessibility at FOX binding sites

Understanding these interactions could provide insights into targeting TMEM199-dependent gene regulation for therapeutic purposes in cancer and other diseases.

What controls should be included when studying TMEM199's effects on immune checkpoint regulation?

Proper experimental controls are essential when studying TMEM199's role in immune checkpoint regulation:

What techniques can be used to create and validate TMEM199 knockout or knockdown models in rats?

Creating effective TMEM199 knockout or knockdown rat models requires careful consideration of several technical approaches:

  • CRISPR/Cas9-Mediated Genome Editing:

    • Design guide RNAs targeting early exons of the rat Tmem199 gene

    • Screen for frameshift mutations that result in premature stop codons

    • Validate knockout by sequencing, western blotting, and immunohistochemistry

  • Conditional Knockout Strategies:

    • Generate floxed Tmem199 alleles using CRISPR/Cas9

    • Cross with tissue-specific Cre-expressing rat lines for organ-specific studies

    • Particularly valuable for studying functions in specific tissues while avoiding potential developmental effects

  • RNA Interference Approaches:

    • Design shRNA constructs targeting rat Tmem199 mRNA

    • Deliver using lentiviral or adenoviral vectors for in vivo applications

    • This approach has been used successfully for targeting transcription factors in TMEM199 studies

  • Validation Requirements:

    • Perform western blotting and immunohistochemistry to confirm reduced TMEM199 protein levels

    • Assess known functional readouts, such as CD274/PD-L1 expression levels, to confirm functional knockdown

    • Test for expected phenotypes based on known TMEM199 functions (e.g., altered PD-L1 expression, changes in glycosylation patterns)

For researchers studying TMEM199-CDG, generating rat models with mutations equivalent to those found in human patients (such as the c.128delA frameshift variant) would be particularly valuable .

How can researchers investigate TMEM199's potential as a therapeutic target in cancer immunotherapy?

Investigating TMEM199 as a therapeutic target requires a multi-faceted approach:

  • Target Validation:

    • Confirm TMEM199's role in immune escape across multiple cancer models

    • Evaluate correlation between TMEM199 expression and response to existing immunotherapies

    • The research has already established that "TMEM199 is a targetable immune regulator"

  • Drug Discovery Approaches:

    • Leverage the finding that "the proton pump inhibitor (PPI) omeprazole significantly decreased TMEM199 protein levels" and "CD274 mRNA was largely decreased by omeprazole"

    • Screen for compounds with increased specificity for TMEM199

    • Develop structure-based drug design strategies targeting specific domains

  • Combination Strategies:

    • Test TMEM199 inhibition in combination with existing immunotherapies

    • Investigate synergistic effects with PD-1/PD-L1 inhibitors given TMEM199's role in regulating PD-L1

  • Biomarker Development:

    • Establish whether TMEM199 expression or localization can predict response to immunotherapy

    • Develop assays to monitor TMEM199 nuclear localization in patient samples

  • Addressing Potential Limitations:

    • Investigate effects of TMEM199 inhibition on glycosylation pathways to anticipate potential side effects

    • The concurrent work noted in the research aims "to illustrate the role of TMEM199 in influencing PPI immunotherapy and then seek a replacement drug for the patients who accept immunotherapy and chemotherapy"

These approaches could help establish TMEM199 as a novel target for enhancing cancer immunotherapy efficacy.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.