Recombinant Rat Transmembrane protein 204 (Tmem204)

What is the structural composition of Tmem204 and how does it compare across species?

Tmem204 is a four-transmembrane protein with high sequence conservation across mammalian species. The rat Tmem204 shares 97% sequence identity with mouse orthologs and has substantial homology with human TMEM204 . The protein contains specific domains that facilitate its localization to cell-cell junctions. The transmembrane topology is critical for its function, with extracellular loops that participate in intercellular interactions. The C-terminal domain (amino acids 192-226 in humans) contains important regulatory regions with the sequence HKREDCMAPRVIVISRSLTARFRRGLDNDYVESPC that can be leveraged as control fragments in experimental protocols . When designing experiments with rat Tmem204, researchers should consider this high conservation when interpreting cross-species studies.

What is the cellular localization pattern of Tmem204 and how can it be visualized?

Tmem204 demonstrates a distinct localization pattern, primarily found at cell-cell junctions where it co-localizes with beta-catenin, an adherens junction-associated protein . Importantly, Tmem204 does not co-localize with tight junction proteins, distinguishing its functional role from other junction-associated transmembrane proteins. For effective visualization, immunofluorescence microscopy using validated antibodies against Tmem204 can be employed, often with counterstaining for beta-catenin to confirm proper localization. When performing co-localization studies, pre-incubation of antibodies with recombinant protein control fragments (at 100x molar excess) for 30 minutes at room temperature can serve as important negative controls to validate staining specificity . Confocal microscopy is particularly useful for resolving the precise membrane localization pattern.

What expression patterns does Tmem204 exhibit across different rat tissues?

Based on comparative data with other mammalian models, Tmem204 demonstrates highest expression in lung, heart, kidney, and placental tissues . Expression analysis via quantitative PCR and western blotting reveals tissue-specific regulation patterns that may correspond to functional requirements for cell adhesion in these organs. The protein appears to be expressed in vascular endothelial cells across multiple tissue types, suggesting a role in vascular function. When analyzing expression patterns in rat tissues, normalization with appropriate housekeeping genes is essential, with GAPDH and beta-actin often serving as suitable references for comparative tissue analysis. Researchers should be aware that expression levels may change under hypoxic conditions, as Tmem204 is known to be upregulated during hypoxia .

What are the optimal conditions for expressing and purifying recombinant rat Tmem204?

For successful expression of recombinant rat Tmem204, E. coli-based expression systems have proven effective, particularly when expressing specific domains rather than the full transmembrane protein . For full-length protein expression, mammalian expression systems like HEK293 cells may yield better results with proper membrane protein folding. When designing expression constructs, consider adding affinity tags such as His-tag for purification purposes, preferably at the N-terminus to avoid interference with C-terminal functional domains.

For purification, a two-step protocol is recommended: initial isolation using affinity chromatography (Ni-NTA for His-tagged constructs) followed by size exclusion chromatography to achieve >80% purity as confirmed by SDS-PAGE and Coomassie blue staining . Optimal buffer conditions include PBS with 1M urea at pH 7.4 without preservatives for most applications . Purified protein should be stored at -20°C, with aliquoting recommended to avoid repeated freeze-thaw cycles that can compromise protein integrity and activity.

How can I validate the functionality of recombinant rat Tmem204 in experimental systems?

Functional validation of recombinant rat Tmem204 should employ multiple complementary approaches. First, assess proper folding and conformation using circular dichroism spectroscopy, particularly important for transmembrane proteins. Second, validate biological activity through cell adhesion assays, as overexpression of Tmem204 has been demonstrated to decrease adhesion between cells .

For antibody blocking experiments, use the recombinant protein fragment as a control by pre-incubating the antibody with a 100x molar excess of the protein fragment for 30 minutes at room temperature before application in immunohistochemistry, immunocytochemistry, or western blotting . This approach confirms antibody specificity and can help validate experimental observations. When expressing recombinant Tmem204 in cell lines, confirmation of proper membrane localization through fractionation studies and co-immunoprecipitation with known interacting partners like beta-catenin provides additional functional validation.

What methodological approaches are recommended for studying Tmem204 gene expression regulation?

Several methodological approaches can effectively analyze Tmem204 gene expression regulation. Quantitative RT-PCR remains the gold standard for measuring transcript levels, with proper primer design spanning exon-exon junctions to avoid genomic DNA amplification. When designing qPCR studies, reference genes should be carefully selected based on the experimental conditions, as standard housekeeping genes may be affected by hypoxia or other treatments that regulate Tmem204.

For studying transcriptional regulation, promoter analysis using luciferase reporter assays can identify key regulatory elements. ChIP assays can detect transcription factor binding to the Tmem204 promoter region. RNA sequencing approaches provide comprehensive expression profiles, with single-cell RNA-seq offering insights into cell-type-specific expression patterns . When analyzing Tmem204 expression changes in response to chemical treatments, multiple time points should be included as expression changes may be transient or delayed, as seen in studies of various compounds affecting Tmem204 expression .

How is Tmem204 implicated in neurological disorders and what models best recapitulate these conditions?

Emerging evidence suggests significant involvement of Tmem204 in neurological disorders, particularly epilepsy . A homozygous change in the TMEM204 gene was identified in a patient with seizures, developmental regression, and abnormal muscle tone , indicating the protein's potential role in neuronal function and development. To investigate these neurological implications, several experimental models can be employed.

Rat models with conditional Tmem204 knockout in specific neuronal populations using CRISPR/Cas9 technology can help elucidate its role in neurodevelopment and seizure susceptibility. Primary neuronal cultures from these models can assess cellular morphology, synapse formation, and electrophysiological properties. For functional studies, techniques such as electroencephalography (EEG) in Tmem204-deficient rats can detect seizure activity, while behavioral testing can assess cognitive and motor functions. When designing these experiments, careful consideration of developmental timing is essential, as Tmem204 may have stage-specific roles in neuronal development and function.

What is the relationship between Tmem204 and cancer progression, particularly in pancreatic ductal adenocarcinoma?

Tmem204 has been identified as a key transmembrane protein gene in pancreatic ductal adenocarcinoma (PDAC) through comprehensive machine learning analyses of single-cell and bulk RNA sequencing data . The protein contributes to a prognostic risk score that stratifies patients into high-risk and low-risk groups with distinct survival outcomes. This indicates potential roles in cancer progression and therapeutic response.

For investigating Tmem204's role in cancer, researchers should consider both in vitro and in vivo approaches. In vitro studies using PDAC cell lines with Tmem204 knockdown or overexpression can assess changes in proliferation, migration, invasion, and resistance to therapy. Orthotopic rat models of PDAC with modified Tmem204 expression provide in vivo insights into tumor growth, metastasis, and therapeutic response. Single-cell RNA sequencing of tumor samples is particularly valuable for understanding Tmem204 expression in different cell populations within the tumor microenvironment . When designing these experiments, consideration of the hypoxic tumor microenvironment is essential, as Tmem204 is induced under hypoxic conditions .

How does Tmem204 respond to chemical exposures and what are the implications for toxicological research?

Rat Tmem204 expression is significantly modulated by various chemical exposures, making it a potentially valuable marker for toxicological studies . Multiple compounds have been shown to affect Tmem204 expression in rodent models, including tetrachlorodibenzodioxin, bisphenol S, vinylidene chloride, and various environmental toxins . These expression changes may reflect cellular adaptation or stress responses to chemical insults.

For toxicological research, time-course and dose-response experiments measuring Tmem204 expression changes can provide insights into mechanisms of toxicity. Primary rat hepatocytes or renal cells are particularly relevant model systems given the high expression of Tmem204 in these tissues. High-throughput screening approaches can identify novel compounds affecting Tmem204 expression. When interpreting results, researchers should control for hypoxic conditions, as chemical-induced hypoxia may indirectly affect Tmem204 expression rather than representing direct transcriptional regulation .

What gene-editing strategies are most effective for creating Tmem204 knockout or knockin rat models?

CRISPR/Cas9 technology offers the most efficient approach for generating Tmem204 knockout or knockin rat models, with several strategic considerations for optimal results. When designing guide RNAs, target early exons to ensure complete loss of function in knockout models. Typically, two gRNAs targeting different exons can increase efficiency and enable PCR-based genotyping through deletion of the intervening sequence . For knockin models, homology-directed repair templates should include selectable markers like GFP-P2A-Puro cassettes flanked by LoxP sites for potential conditional applications .

Verification of successful editing requires comprehensive validation through genomic PCR, sequencing, RT-PCR, western blotting, and functional assays. Off-target effects should be assessed through whole-genome sequencing or targeted sequencing of predicted off-target sites. When establishing breeding colonies, consider potential developmental effects, as complete Tmem204 knockout might affect viability based on its role in cell adhesion. Alternative approaches include conditional knockouts using Cre-LoxP systems, which allow tissue-specific or inducible deletion to circumvent potential developmental lethality.

How can single-cell analysis techniques be applied to understand Tmem204 function in heterogeneous tissues?

Single-cell RNA sequencing represents a powerful approach for analyzing Tmem204 expression and function in complex tissues with heterogeneous cell populations. This technique has successfully identified cell type-specific expression patterns of Tmem204 in tumor microenvironments, including epithelial cells, fibroblasts, T cells, and macrophages . For optimal results, fresh tissue dissociation protocols must be optimized to maintain cell viability while achieving sufficient single-cell suspension.

Beyond transcriptomics, single-cell proteomics using mass cytometry (CyTOF) with Tmem204 antibodies can quantify protein levels at the single-cell level. Spatial transcriptomics or multiplexed immunofluorescence preserves tissue architecture while assessing Tmem204 expression patterns. For functional analysis, pseudo-time trajectory analysis of single-cell data can reveal the dynamics of Tmem204 expression during developmental or pathological processes . When analyzing single-cell data, computational approaches including dimensionality reduction (t-SNE, UMAP) and clustering algorithms help identify cell populations with distinct Tmem204 expression patterns and correlate with other genes to infer functional pathways.

What protein interaction networks involve Tmem204 and how can they be comprehensively mapped?

Tmem204 participates in complex protein interaction networks, particularly at cell-cell junctions where it interacts with adherens junction proteins like beta-catenin . To comprehensively map these interactions, multiple complementary approaches should be employed. Immunoprecipitation followed by mass spectrometry (IP-MS) using antibodies against rat Tmem204 can identify native protein complexes. For higher specificity, BioID or APEX2 proximity labeling, where Tmem204 is fused with a biotin ligase, can identify proteins in close proximity within the cellular environment.

Yeast two-hybrid screening provides an alternative approach for detecting direct protein-protein interactions. Validation of identified interactions should employ multiple methods, including co-immunoprecipitation, FRET/BRET analysis, and in situ proximity ligation assays. Computational prediction of protein-protein interactions based on structural modeling can guide experimental design. When conducting these studies, membrane protein interactions present specific challenges requiring appropriate detergents for solubilization while preserving native interactions. Controls should include both unrelated transmembrane proteins and cytoplasmic proteins to distinguish specific from non-specific interactions.

How might modulation of Tmem204 be exploited for therapeutic purposes in epilepsy or neurodevelopmental disorders?

Given the emerging association between Tmem204 and neurological disorders including epilepsy and developmental abnormalities , several therapeutic strategies targeting this protein merit investigation. Antisense oligonucleotides (ASOs) or siRNA approaches could downregulate Tmem204 expression in hyperexcitable neuronal populations. Conversely, viral vector-mediated overexpression might restore function in cases of loss-of-function mutations. Small molecule modulators of Tmem204 function or localization could be identified through high-throughput screening approaches.

For evaluating therapeutic efficacy, electrophysiological recordings in both in vitro neuronal cultures and in vivo models can assess effects on neuronal excitability and seizure susceptibility. Behavioral testing in rat models can evaluate improvements in cognitive function and motor coordination. When designing therapeutic interventions, consider the developmental timing of Tmem204 expression, as optimal intervention windows may exist during critical periods of neurodevelopment. Evaluation of potential off-target effects is crucial, particularly in non-neuronal tissues with high Tmem204 expression such as lung and kidney .

What is the potential of Tmem204 as a biomarker or therapeutic target in cancer, particularly pancreatic ductal adenocarcinoma?

Tmem204 has significant potential as both a biomarker and therapeutic target in cancer, particularly in pancreatic ductal adenocarcinoma (PDAC) where it has been identified as one of five key TMEM genes with prognostic significance . As a biomarker, Tmem204 expression levels contribute to a risk score signature that effectively stratifies patients into high and low-risk groups with distinct survival outcomes and potentially different therapeutic responses.

For therapeutic targeting, several approaches warrant investigation. Monoclonal antibodies against extracellular domains of Tmem204 could disrupt its function in cell adhesion or trigger antibody-dependent cellular cytotoxicity. Small molecule inhibitors targeting Tmem204 function might modulate cancer cell behavior. For evaluating these approaches, patient-derived xenograft models maintain tumor heterogeneity while allowing therapeutic testing. When designing Tmem204-targeted therapies, considerations include potential effects on normal tissues with high expression, delivery methods to reach solid tumors, and combination strategies with conventional therapies like chemotherapy or radiation .

What are the most promising future research directions for Tmem204 and what methodological advances would enable these investigations?

The multifaceted roles of Tmem204 in cell adhesion, hypoxic response, neurological function, and cancer progression suggest several promising research directions. First, comprehensive characterization of Tmem204 signaling pathways using phosphoproteomics and interactomics would elucidate its functional mechanisms. Second, tissue-specific conditional knockout models would clarify its role in development and disease without confounding systemic effects. Third, investigation of Tmem204 in additional disease contexts, particularly vascular disorders given its expression pattern, could reveal novel functions.