Recombinant Rat Transmembrane protein 225 (Tmem225)

Shipped with Ice Packs
In Stock

Description

Genomic Organization (Rat) :

ExonSize (bp)Intron Size (bp)
1299684
2147270
3135695
4329PolyA signal

Expression and Localization

Tissue specificity:

  • Exclusively expressed in rat testis, detectable after 13 months of age .

  • Localizes to spermatocyte cells and round spermatids in seminiferous tubules .

Subcellular distribution:

  • Concentrates around the nuclear membrane and disperses in the cytoplasm .

  • Requires the N-terminal transmembrane domain for proper localization; deletion disrupts nuclear membrane association .

Key Findings from Knockout Models :

ParameterTMEM225-Null Sperm vs. Wild-Type
MotilitySignificantly reduced
Flagellar morphologyHairpin-loop configuration
ROS levelsElevated
Mitochondrial functionImpaired
  • Mechanistic insights:

    • Regulates sperm maturation in the epididymis by modulating mitochondrial function, glycolysis, and flagellar morphology .

    • Interacts with PP1γ2 via its RVxF motif, inhibiting phosphatase activity critical for spermatogenesis and sperm motility .

Product Details (Creative Biomart) :

ParameterDescription
SpeciesRat
Expression HostMammalian Cells
TagHis
Purity>80%
Storage-80°C (lyophilized) or +4°C (liquid)
ApplicationsELISA, WB, functional assays

Research Applications and Implications

  • Infertility studies: TMEM225 dysregulation is linked to nonobstructive azoospermia in humans .

  • Sperm maturation: Recombinant TMEM225 aids in studying post-testicular sperm modifications, particularly mitochondrial and flagellar dynamics .

  • Drug discovery: Potential target for therapies addressing asthenospermia or oxidative stress in sperm .

Comparative Conservation Across Species

SpeciesIdentity (%)Similarity (%)
Human4364
Mouse8391
Dog4565

Rat TMEM225 shares high homology with mouse orthologs, making murine models reliable for functional studies .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipment is required, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
Tmem225; Pmp22cd; Transmembrane protein 225
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Tmem225
Target Protein Sequence
MMRIPNRSIQAANIFFSSGAILLLIAGLIMENWVELIPKVRKDKVTHSPWLGCCPPFWPE ESLEAIRRMMMMSLNISIYLNLIIGLQFTYMISQNKCVHLLIGFLSFFTGCLLFYAIIVY HHKLNKGQYVYFVNYKTKWIVFTIYLTIALFLTCGIFSFIQCTNRCACMKFCVPHTESSS KAMTQNTIQVISLPPRSEMPRSIVHMHSDMPGKEGSISKPHLQSRRVTWAL
Uniprot No.

Target Background

Function
TMEM225 is believed to inhibit protein phosphatase 1 (PP1) in sperm by binding to its catalytic subunit PPP1CC.
Gene References Into Functions
  1. TMEM225 appears to play a crucial role in sperm degeneration but not in spermatogenesis. PMID: 20979528
Database Links
Subcellular Location
Cytoplasmic vesicle, secretory vesicle, acrosome membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in testis, specifically in spermatocytes and round spermatids.

Q&A

What is Rat Transmembrane Protein 225 (TMEM225)?

Rat TMEM225 is a novel transmembrane protein specifically expressed in rat testis. It contains an open reading frame with a length of 696 bp, encoding a protein with four putative transmembrane helices. The protein has a molecular weight of approximately 26.7 kDa and an isoelectric point of 9.45. TMEM225 has been mapped to chromosome 8q22 by browsing the University of California Santa Cruz genomic database.

What is the structural composition of TMEM225?

TMEM225 comprises four alpha-helical transmembrane domains (TM-1, TM-2, TM-3, and TM-4) of 20, 23, 20, and 20 amino acids, respectively. It contains N- and C-terminal cytoplasmic domains of 10 and 71 amino acids, respectively, two intracellular loops of 39 and 20 amino acids, and a short extracellular loop of eight amino acids. The protein has a relatively short N-terminus tail and a longer C-terminus of more than 71 residues.

What is the genomic organization of the Rat TMEM225 gene?

The rat TMEM225 gene is composed of four exons and three introns. The open reading frame extends from nucleotides 119 to 814, with the ATG start codon (nucleotides 119–121) preceded by an in-frame stop codon TAG. Interestingly, the gene lacks any typical polyadenylation signal. The exon-intron structure follows specific splicing patterns with conserved gt-ag splicing signals at the junctions.

3′ Splice acceptorExonSize (bp)5′ Splice donorIntronSize (bp)
cDNA end CGACGCTCCG1299TGGCCTGAAG gtcagaacta1684
ttcccaac agAGAGCCTGGA2147TTCTTCACAG gtagcttcct2270
tgaacact agGTTGCCTTTT3135CTTACCTGTG gtaagtatcc3695
ctgtccct agGTATCTTCAG4329GGAAAGATTC aaaaaaaaaPolyA

Where is TMEM225 expressed in rat tissues?

TMEM225 shows a tissue-specific expression pattern, being exclusively expressed in rat testis. RT-PCR analysis of various tissues including lung, liver, heart, testis, skeletal muscle, kidney, and ovary revealed that TMEM225 mRNA expression was detected only in the testis, confirming its testis-specific expression pattern.

Does TMEM225 expression vary with age in rats?

Yes, TMEM225 demonstrates a distinct age-dependent expression pattern. RT-PCR analysis of testis from rats of different ages showed that TMEM225 expression begins around 13 months of age in adult rat testis. This age-dependent expression suggests that TMEM225 may have specific functions related to the adult testis and is not involved in early testicular development.

Which cell types in the testis express TMEM225?

In situ hybridization analysis revealed that TMEM225 mRNA is mainly expressed in spermatocyte cells and round spermatids within the testis. The presence of TMEM225 mRNA is indicated by brown staining of the cytoplasm of these specific cell types. This expression pattern was only observed in testes from 14-month-old rats but was not detected in 6-month-old rats, further confirming the age-dependent expression of TMEM225.

What is the subcellular localization of TMEM225?

Green fluorescence protein (GFP) localization analysis demonstrated that rat TMEM225 is predominantly located surrounding the nuclear membrane, with a minority distribution in the cytoplasm. This subcellular localization pattern suggests that TMEM225 may function in processes involving the nuclear envelope or nuclear-cytoplasmic transport in testicular cells.

Is TMEM225 conserved across different species?

TMEM225 is highly conserved across various mammalian species. BLASTP analysis identified orthologs in human, chimpanzee, monkey, dog, mouse, cow, and horse. Multiple alignment analysis revealed several highly conserved features, including six serine residues and seven leucine residues that are preserved across all species examined. Additionally, two amino acid blocks (PRSIV and VTWAL) in the C-terminus are highly conserved, suggesting functional importance.

What is the degree of sequence homology between rat TMEM225 and its orthologs?

Rat TMEM225 shares significant homology with its orthologs in various species. The highest similarity is with mouse TMEM225 (83% identity and 91% similarity), reflecting their close evolutionary relationship. Rat TMEM225 also shares homology with human (43% identity and 64% similarity), chimpanzee (44% identity and 64% similarity), monkey (43% identity and 63% similarity), dog (45% identity and 65% similarity), cow (41% identity and 61% similarity), and horse (40% identity and 62% similarity).

Are there any genomic features associated with the chromosomal location of TMEM225?

An interesting genomic feature is that TMEM225 is located in close proximity to a cluster of 41 olfactory receptor genes (Olr1301 to Olr1341) at the same chromosomal locus (rat 8q22). This clustering pattern might suggest possible co-regulation or evolutionary relationships between these genes, although further research would be needed to establish any functional connection.

How can TMEM225 be cloned from rat testis?

The methodology for cloning rat TMEM225 involves several key steps:

  • Primer design based on homologous regions identified through BLAST searches (e.g., using mouse homologs)

  • PCR amplification using adult rat testis cDNA as template

  • PCR conditions: 94°C for 5 min, followed by 35 cycles of 20 s at 94°C, 30 s at 56.5°C, and 50 s at 72°C, with a final extension of 5 min at 72°C

  • T-A cloning of the PCR product

  • Sequencing on an ABI PRISM sequencer for verification

What techniques are effective for studying TMEM225 expression patterns?

Multiple complementary techniques have proven effective for analyzing TMEM225 expression:

  • Reverse Transcription-PCR (RT-PCR): For tissue-specific and age-dependent expression analysis using primers TMEM225-F (5′-ATA AAG TTA CCC ACA GTC C-3′) and TMEM225-R (5′-TCA TTG CTT TGC TGC TAC-3′)

  • In situ hybridization: For cellular localization within tissues, using multiple short oligonucleotide probes labeled with digoxigenin

  • GFP fusion protein analysis: For subcellular localization studies using recombinant expression vectors

How can subcellular localization of TMEM225 be determined?

The subcellular localization of TMEM225 can be effectively studied using GFP fusion protein analysis:

  • Subclone the TMEM225 open reading frame into a GFP expression vector (e.g., pEGFP-C1)

  • Create deletion mutants (e.g., N-terminal 35 amino acids–deleted mutant pEGFP-D35-TMEM225) to study domain functions

  • Transfect mammalian cells (e.g., HeLa cells) with the recombinant vectors

  • Fix cells in paraformaldehyde and permeabilize with Triton X-100

  • Counterstain nuclei with DAPI

  • Visualize using fluorescence microscopy

What are the optimal in situ hybridization protocols for TMEM225 detection?

For optimal in situ hybridization of TMEM225 in rat testis:

  • Fix testis tissues in ice-cold 4% paraformaldehyde for 2 hours

  • Soak tissues in 40% sucrose overnight for cryoprotection

  • Freeze tissues at -20°C and cut 30-μm sections

  • Use multiple short oligonucleotide probes labeled with digoxigenin for better penetration and stronger signals

  • Perform prehybridization for 3 hours before adding the labeled probes

  • Recommended probe sequences:

    • 5′-CCA CAG TCC ATG GCT GGG ATG CTG TCC TCC TTT-3′

    • 5′-GCA GTT CAC CTA CAT GAT TTC TCA AAA TAA GTG TG-3′

    • 5′-AAC AGA TGT GCG TGC ATG AAA TTC TGT GTA CCC CA-3′

How does deletion of the N-terminal transmembrane domain affect TMEM225 localization?

The distribution of TMEM225 is significantly affected by the deletion of the N-terminal transmembrane domain. While wild-type TMEM225 predominantly localizes around the nuclear membrane with some cytoplasmic distribution, deletion mutants show altered localization patterns. This suggests that the N-terminal domain plays a crucial role in proper targeting of TMEM225 to its correct subcellular compartment, potentially through interactions with trafficking machinery or membrane insertion mechanisms.

What is the potential role of TMEM225 in testicular function?

Based on its expression patterns and characteristics, TMEM225 may play an important role in sperm degeneration rather than spermatogenesis. The evidence supporting this hypothesis includes:

  • Age-dependent expression beginning only after 13 months of age

  • Expression pattern not coinciding with the first wave of spermatozoon development

  • Specific expression in spermatocyte cells and round spermatids

  • Nuclear membrane localization suggesting potential roles in nuclear processes

These findings collectively suggest that TMEM225 may function in age-related processes in the testis rather than in developmental spermatogenesis.

What are the implications of TMEM225's genomic proximity to olfactory receptor genes?

The clustering of TMEM225 with 41 olfactory receptor genes (Olr1301 to Olr1341) at rat chromosome 8q22 raises interesting questions about potential functional or regulatory relationships. This genomic arrangement could suggest:

  • Shared evolutionary history or gene duplication events

  • Common regulatory elements influencing expression

  • Potential involvement in sensory functions related to reproduction

Future research could investigate whether this genomic proximity translates to functional relationships between TMEM225 and olfactory receptors in reproductive biology.

What experimental approaches could be used to determine the function of TMEM225 in aging testes?

To investigate the function of TMEM225 in aging testes, several sophisticated experimental approaches could be employed:

  • Conditional knockout models: Generate testis-specific or age-inducible TMEM225 knockout rats to examine phenotypic changes

  • Proteomics analysis: Identify interaction partners of TMEM225 through co-immunoprecipitation followed by mass spectrometry

  • Transcriptome analysis: Compare gene expression profiles between wild-type and TMEM225-deficient testis tissues

  • Electron microscopy: Examine ultrastructural changes in nuclear membrane organization in the presence/absence of TMEM225

  • Live-cell imaging: Track the dynamics of TMEM225 during testicular aging processes using fluorescent reporter systems

What are the key unanswered questions about TMEM225?

Several important questions about TMEM225 remain to be addressed:

  • The precise molecular function of TMEM225 at the nuclear membrane

  • The signaling pathways or molecular mechanisms regulating age-dependent TMEM225 expression

  • The specific role of TMEM225 in sperm degeneration processes

  • The functional significance of the conserved amino acid blocks (PRSIV and VTWAL) in the C-terminus

  • Potential interactions between TMEM225 and other proteins involved in testicular aging

What new technologies might advance TMEM225 research?

Emerging technologies that could significantly advance our understanding of TMEM225 include:

  • CRISPR-Cas9 genome editing: For precise modification of TMEM225 and investigation of structure-function relationships

  • Single-cell transcriptomics: To better characterize cell-specific expression patterns within the testis

  • Cryo-electron microscopy: For high-resolution structural analysis of TMEM225 within membranes

  • Proximity labeling proteomics (BioID or APEX): To identify proteins in close proximity to TMEM225 at the nuclear membrane

  • Organ-on-chip technologies: To model testicular aging and investigate TMEM225 function in physiologically relevant systems

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.