Recombinant Rat Transmembrane protein 232 (Tmem232)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Rat Transmembrane protein 232 (Tmem232) is a protein that, in rats, is encoded by the Tmem232 gene . It is a full-length protein, often expressed in E. coli and fused with an N-terminal His tag to aid in purification and identification . Tmem232 has implications in atopic dermatitis and sperm flagellum formation .

Basic Information

FeatureDescription
Gene NameTmem232
SynonymsTmem232, Transmembrane protein 232
UniProt IDB1WBT0
SpeciesRat
SourceE. coli
TagHis-Tagged
Protein LengthFull Length (1-617 aa)
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles .
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionBriefly centrifuge prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃ is recommended .
AA SequenceMASKKWPSFSVTKEFILRFNNTDNRVKEEELLEQARKFTVRCKRKLGLKTLGSGKHVHLPTAWAEVIYLAQCKGEIQDEALNMLYASLDHVSFDCDQLPTLFFLAESVLYRLCCDAFKKEYLYSVEIKLVKIGYLIFLRLFVFFLHGHLENFKQHLLRLQPYLYALYYSEPSYYKYPNILSSLQFILKTAEIICKRELHFEVFESLREVEDPFSDTNHVQLNKRGYEVNHLLWHSVAAWSCVQDNRPQLNAVLDHILFHKAQLQTKCWLDSALALLVLGEAAKLNMACLKTLMDLMTHFLLSPQSQEDYCSIYDIPWASDIVFIYTSIIAEVCLYAATSDLRKTALIGFCVCKDPQQDIHLTNKSEEMPELDGASILTLLKYFSSRISDNCAKVIWVGYYGIVYNLVKMSWELQGDEEQDGFRNMVWQTLQKIKDYEEDPRIQNAVTIAQAELNDAADPFSSKAAPNSEAFSKYIGWRIA NTLSRLFFPSLDVSALPQKTPVETDLQRKHTISKRQPEKKGVVRIVMKEHPSVLELSMFPYPDFFTKADKKLEEVIDHHWQKDMETLKQIEAVCEAQNRKDEEEKEKIRFQEIMKQRERKLNKQTKPYEITPSEKKE

3.1. Association with Atopic Dermatitis

TMEM232 is statistically significantly associated with atopic dermatitis (AD) . A study involving sequencing analysis found that TMEM232, located in the 5q22.1 region, is linked to AD .

3.2. Role in Sperm Flagellum Formation and Male Fertility

TMEM232 is essential for sperm flagellum formation and male fertility . Tmem232 knockout (KO) male mice are infertile, and their sperm are immotile with morphological defects of the flagellum . TMEM232 deficiency disrupts ribosomal quantity control during spermiogenesis and adversely affects sperm energy supply for its motility . TMEM232 interacts with the ATG14 protein and may be involved in autophagy to regulate spermatogenesis .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with blue ice packs by default. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Tmem232; Transmembrane protein 232
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-617
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Tmem232
Target Protein Sequence
MASKKWPSFSVTKEFILRFNNTDNRVKEEELLEQARKFTVRCKRKLGLKTLGSGKHVHLP TAWAEVIYLAQCKGEIQDEALNMLYASLDHVSFDCDQLPTLFFLAESVLYRLCCDAFKKE YLYSVEIKLVKIGYLIFLRLFVFFLHGHLENFKQHLLRLQPYLYALYYSEPSYYKYPNIL SSLQFILKTAEIICKRELHFEVFESLREVEDPFSDTNHVQLNKRGYEVNHLLWHSVAAWS CVQDNRPQLNAVLDHILFHKAQLQTKCWLDSALALLVLGEAAKLNMACLKTLMDLMTHFL LSPQSQEDYCSIYDIPWASDIVFIYTSIIAEVCLYAATSDLRKTALIGFCVCKDPQQDIH LTNKSEEMPELDGASILTLLKYFSSRISDNCAKVIWVGYYGIVYNLVKMSWELQGDEEQD GFRNMVWQTLQKIKDYEEDPRIQNAVTIAQAELNDAADPFSSKAAPNSEAFSKYIGWRIA NTLSRLFFPSLDVSALPQKTPVETDLQRKHTISKRQPEKKGVVRIVMKEHPSVLELSMFP YPDFFTKADKKLEEVIDHHWQKDMETLKQIEAVCEAQNRKDEEEKEKIRFQEIMKQRERK LNKQTKPYEITPSEKKE
Uniprot No.

Target Background

Database Links

KEGG: rno:501199

UniGene: Rn.162274

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What tissue expression pattern does Tmem232 exhibit?

Tmem232 demonstrates a distinctive tissue expression profile, with highest expression levels in the testis. RT-PCR analysis of adult mouse tissues has revealed weak expression in the spleen, liver, brain, uterus, lung, epididymis, and kidney, while expression is not detected in the heart or ovary .

Developmental analysis has shown that Tmem232 mRNA expression increases significantly around postnatal day 21 in mice, corresponding approximately to the haploid and round spermatid stage of spermatogenesis . This temporal expression pattern suggests Tmem232 plays a critical role in late-stage spermatogenesis.

In pathological conditions such as atopic dermatitis (AD), Tmem232 expression becomes significantly upregulated in skin lesions compared to normal skin, indicating its involvement in inflammatory skin conditions .

How is recombinant Tmem232 produced for research applications?

Recombinant rat Tmem232 production typically employs heterologous expression systems, with E. coli being a common host. For laboratory research, the following methodological approach is generally employed:

  • The full-length rat Tmem232 coding sequence (amino acids 1-617) is cloned into an expression vector containing an N-terminal His-tag for purification.

  • The construct is transformed into E. coli expression strains.

  • Protein expression is induced under optimized conditions.

  • The recombinant protein is purified using affinity chromatography methods, typically employing Ni-NTA resins that bind the His-tag.

  • The purified protein is typically lyophilized in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 for stability during storage.

  • For reconstitution, the lyophilized protein is dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with 5-50% glycerol added for long-term storage stability at -20°C/-80°C .

Quality control typically involves SDS-PAGE analysis to confirm purity (>90%) and molecular weight verification .

What are the established functions of Tmem232 in biological systems?

Current research has established two primary physiological roles for Tmem232:

Role in Inflammation/Atopic Dermatitis:
Tmem232 is significantly upregulated in skin lesions of patients with atopic dermatitis (AD) and in experimental AD models. It promotes inflammatory responses through activation of nuclear factor-κB (NF-κB) and signal transducer and activator of transcription 3 (STAT3) pathways. This creates a self-amplifying inflammatory loop through the interleukin-4 (IL-4)/STAT6 axis, exacerbating AD symptoms .

Role in Male Fertility:
Tmem232 is critical for male fertility, as demonstrated in knockout mouse models. It functions in:

  • Maintaining sperm flagellar structural integrity, particularly the 7th outer microtubule doublet and its corresponding outer dense fiber

  • Facilitating proper cytoplasm removal during spermiogenesis

  • Ensuring normal sperm motility through interaction with the outer dense fiber protein ODF1

The deletion of Tmem232 results in male-specific infertility characterized by abnormal sperm morphology and severely impaired motility .

What experimental models are available for studying Tmem232 function?

Several experimental models have been developed to investigate Tmem232 function:

In vivo models:

  • Tmem232 knockout mice: Generated using CRISPR-Cas9 technology targeting exons 4-8 of the Tmem232 gene. This model shows:

    • Male-specific infertility

    • Normal testis size and weight

    • Severely abnormal sperm morphology

    • Impaired sperm motility

  • MC903-induced AD mouse model: Used to study Tmem232's role in inflammation:

    • Tmem232-/- mice exhibit reduced dermatitis severity

    • Decreased mast-cell infiltration

    • Reduced expression of Th1 and Th2-related inflammatory factors in skin tissue

In vitro models:

  • Human keratinocyte models: Primary keratinocytes and immortalized HaCaT cells stimulated with inflammatory factors to study Tmem232's role in inflammation

  • Plasmid expression systems: Mouse Tmem232 cloned into pCMV-HA vectors for protein interaction studies via co-immunoprecipitation assays

  • siRNA-mediated knockdown: Tmem232-specific siRNA used for therapeutic potential assessment in AD models

These models provide complementary approaches for studying Tmem232 function in different biological contexts and at various levels of complexity.

What protein interactions have been identified for Tmem232?

Protein interaction studies, particularly co-immunoprecipitation (Co-IP) assays, have identified a critical interaction between Tmem232 and Outer Dense Fiber Protein 1 (ODF1) . This interaction has significant functional implications:

  • ODF1 is essential for maintaining sperm motility and flagellar structure.

  • The Tmem232-ODF1 interaction appears to be crucial for establishing the integrity of the 7th outer microtubule doublet of the sperm axoneme.

  • Disruption of this interaction in Tmem232 knockout mice results in the absence of the 7th outer microtubule doublet and its corresponding outer dense fiber.

This protein partnership explains, at least partially, the molecular mechanism by which Tmem232 contributes to sperm structural integrity and motility. The specific domains mediating this interaction and potential additional binding partners remain areas for further investigation .

How can researchers effectively generate and validate Tmem232 knockout models?

Generating and validating Tmem232 knockout models requires a systematic approach:

Generation Methodology:

  • Target region selection: Exons 4-8 have been successfully targeted in mouse models. This region spans approximately 21,844 bp of the gene .

  • CRISPR-Cas9 system application:

    • Design gRNAs targeting the flanking regions of exons 4-8

    • Co-inject Cas9 and gRNA mRNA into fertilized C57BL/6 mouse eggs

    • Screen founder animals for the desired deletion

Validation Strategies:

  • Genomic DNA sequencing: Confirm deletion in founder animals by sequencing the targeted locus. In established models, the wild-type locus produces a 572 bp PCR product while the knockout locus produces a 424 bp product .

  • RT-PCR analysis: Verify the absence of Tmem232 mRNA expression in tissues of knockout animals, particularly in testis where expression is normally highest.

  • Phenotypic validation:

    • Male fertility assessment through breeding trials

    • Sperm count analysis from caudal epididymis

    • Sperm morphology examination via DIC microscopy

    • Sperm motility quantification using Computer-Assisted Semen Analysis (CASA)

    • Ultrastructural analysis using transmission electron microscopy (TEM)

This comprehensive approach ensures the generation of reliable knockout models for studying Tmem232 function in vivo.

What techniques are optimal for analyzing Tmem232's role in sperm flagellar structure?

Investigating Tmem232's contribution to sperm flagellar structure requires specialized techniques:

Transmission Electron Microscopy (TEM):

  • Cross-sectional analysis: Provides detailed visualization of the 9+2 axoneme structure, allowing identification of specific defects like the missing 7th outer microtubule doublet in Tmem232 knockout sperm .

  • Longitudinal section analysis: Reveals abnormalities in the midpiece-principal piece junction and cytoplasmic remnant retention .

Scanning Electron Microscopy (SEM):
Offers three-dimensional surface visualization of sperm flagella, revealing gross morphological abnormalities like hairpin structures and unsheathed flagella .

Differential Interference Contrast (DIC) Microscopy:
Enables assessment of fresh, unfixed sperm to quantify morphological abnormalities:

  • Hairpin-like structures (41.43% in Tmem232 KO sperm)

  • Sperm aggregation into bundles (11.97% in Tmem232 KO sperm)

  • Unsheathed flagella (8.31% in Tmem232 KO sperm)

Computer-Assisted Semen Analysis (CASA):
Provides quantitative measures of sperm motility parameters:

  • Percentage of motile sperm (82.33% in WT vs. 7.667% in Tmem232 KO)

  • Progressive sperm rate (14.67% in WT vs. 0% in Tmem232 KO)

  • Mean path velocity (significantly decreased in Tmem232 KO)

  • Straight-line velocity (significantly decreased in Tmem232 KO)

Immunofluorescence Analysis:
Using antibodies against axonemal components (e.g., α-tubulin) and outer dense fiber proteins (e.g., ODF2) to visualize structural abnormalities in sperm flagella .

What methodologies are effective for studying Tmem232's role in inflammatory responses?

Research into Tmem232's inflammatory functions employs diverse methodological approaches:

In vivo inflammation models:

  • MC903-induced AD mouse model: Application of MC903 (a vitamin D3 analog) to mouse skin induces AD-like inflammation, serving as a platform to study Tmem232's role in skin inflammation .

  • Tmem232 knockout mice response to MC903: Comparison between wild-type and Tmem232-/- mice reveals differences in:

    • Dermatitis severity

    • Mast-cell infiltration

    • Expression of inflammatory cytokines

In vitro cellular models:

  • Primary human keratinocytes stimulated with inflammatory factors

  • HaCaT cell line (immortalized human keratinocytes) for mechanistic studies

Molecular signaling pathway analysis:

  • Western blotting: Assessing activation of NF-κB and STAT3 pathways

  • qRT-PCR: Measuring expression of inflammation-related genes

  • ELISA: Quantifying cytokine production

Therapeutic intervention studies:

  • Tmem232-specific siRNA application: Topical application to AD-like lesions to assess therapeutic potential

  • Evaluation parameters:

    • Clinical scoring of AD severity

    • Histopathological analysis

    • Inflammatory cytokine expression measurement

This multi-faceted approach allows for comprehensive characterization of Tmem232's role in inflammatory processes and potential therapeutic targeting.

What are the current limitations in Tmem232 research?

Despite recent advances, several key limitations persist in Tmem232 research:

Structural characterization gaps:

  • The three-dimensional structure of Tmem232 remains unknown, limiting understanding of its functional domains and interaction surfaces.

  • The precise membrane topology and orientation of the protein have not been fully determined.

Mechanistic understanding limitations:

  • How Tmem232 regulates cytoplasm removal during spermiogenesis remains poorly understood at the molecular level.

  • The complete signaling network through which Tmem232 influences inflammatory pathways requires further elucidation.

  • The specific binding domains mediating the Tmem232-ODF1 interaction have not been mapped.

Translational research gaps:

Technical challenges:

  • Generating antibodies specific to Tmem232 has proven difficult, limiting immunological detection methods.

  • Due to its multiple transmembrane domains, recombinant expression and purification of full-length, properly folded Tmem232 remains challenging.

Addressing these limitations will be crucial for advancing our understanding of Tmem232 biology and its potential therapeutic applications.

What are promising research directions for Tmem232 studies?

Several high-potential research directions could advance Tmem232 understanding:

Structural biology approaches:

  • Cryo-electron microscopy to determine the three-dimensional structure of Tmem232

  • Protein domain analysis to identify functional regions mediating specific interactions

  • FRET/BRET analyses to study conformational changes during activation

Extended interactome mapping:

  • Proximity labeling techniques (BioID, APEX) to identify Tmem232's protein interaction network

  • Tissue-specific interactome comparison between testis and skin

  • Identification of potential Tmem232-targeting drugs using protein-ligand interaction screens

Translational potential:

  • Development of small molecule inhibitors of Tmem232 for potential AD therapy

  • Exploration of Tmem232's role in male contraception research

  • Investigation of Tmem232 genetic variants in human infertility and inflammatory skin conditions

Mechanistic investigations:

  • Detailed analysis of how Tmem232 regulates the NF-κB and STAT3 pathways

  • Investigation of Tmem232's role in cytoplasm removal during spermiogenesis

  • Studies on potential post-translational modifications regulating Tmem232 function

Expanded disease associations:

  • Examination of Tmem232's potential role in other inflammatory conditions

  • Investigation of possible connections to additional reproductive disorders

  • Exploration of potential involvement in other barrier tissue pathologies

These research directions hold potential for significant advances in understanding Tmem232 biology and developing therapeutic applications.

What are the optimal storage and handling conditions for recombinant Tmem232?

Proper storage and handling of recombinant Tmem232 is critical for maintaining protein integrity and experimental reproducibility:

Storage conditions:

  • Lyophilized protein should be stored at -20°C to -80°C upon receipt.

  • Working aliquots may be maintained at 4°C for up to one week.

  • Repeated freeze-thaw cycles should be avoided as they compromise protein stability.

Reconstitution protocol:

  • Briefly centrifuge vial prior to opening to bring contents to the bottom.

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • Add glycerol to a final concentration of 5-50% (with 50% being optimal) for long-term storage.

  • Prepare small working aliquots to minimize freeze-thaw cycles.

Buffer considerations:

  • Tris/PBS-based buffer with 6% trehalose at pH 8.0 has been validated for stability.

  • For specific applications requiring different buffers, dialysis may be necessary.

Quality control measures:

  • Verify protein integrity by SDS-PAGE before experimental use.

  • Confirm activity/functionality using appropriate binding or activity assays.

  • Monitor for precipitation or aggregation that may indicate loss of protein quality .

These procedures help ensure consistent experimental results when working with recombinant Tmem232.

What statistical approaches are most appropriate for analyzing Tmem232 knockout phenotypes?

For sperm morphology analysis:

  • Categorical data analysis: Chi-square tests for comparing proportions of morphologically abnormal sperm between knockout and wild-type mice.

  • Fisher's exact test: For analysis when sample sizes are small or expected frequencies are low.

  • Multi-category classification: For distinguishing between different types of morphological abnormalities (hairpin structures, cytoplasmic remnants, etc.).

For sperm motility parameters:

  • Student's t-test or Mann-Whitney U test: For comparing continuous variables like percentage of motile sperm, mean path velocity, and straight-line velocity between genotypes.

  • Paired design consideration: When comparing littermates to control for genetic background effects.

  • Multiple comparison correction: When analyzing multiple motility parameters simultaneously.

For inflammatory response data:

  • ANOVA with post-hoc tests: For comparing inflammatory markers across multiple experimental groups.

  • Repeated measures designs: For longitudinal studies of inflammatory progression.

  • Correlation analysis: To assess relationships between Tmem232 expression levels and severity of inflammatory markers.

Sample size considerations:

  • Power analysis should be conducted to determine appropriate sample sizes.

  • For sperm parameters, typically 5-10 mice per genotype are recommended.

  • For inflammation studies, larger groups may be necessary due to higher variability.

Data presentation:

  • Bar graphs with individual data points for transparency.

  • Box plots to show distribution characteristics.

  • Inclusion of effect sizes alongside p-values to indicate biological significance .

These statistical approaches ensure robust and reproducible analysis of Tmem232 knockout phenotypes.

How can researchers effectively design experiments to study Tmem232's dual role in inflammation and fertility?

Investigating Tmem232's dual functionality requires careful experimental design:

Integrated study approaches:

  • Tissue-specific conditional knockout models:

    • Generate Tmem232 floxed mice for conditional deletion

    • Use keratinocyte-specific Cre (e.g., K14-Cre) for skin-specific deletion

    • Use testis-specific Cre (e.g., Stra8-Cre) for germ cell-specific deletion

    • Compare phenotypes to determine tissue-specific functions

  • Domain-specific mutagenesis:

    • Create point mutations or domain deletions in Tmem232

    • Analyze which mutations affect fertility, inflammation, or both

    • Identify functional domains specific to each biological role

  • Rescue experiments:

    • Reintroduce wild-type or mutant Tmem232 into knockout backgrounds

    • Determine which constructs rescue fertility, inflammation, or both phenotypes

Experimental design considerations:

  • Controls:

    • Include littermate controls to minimize genetic background effects

    • Use tissue-matched samples for expression analyses

    • Include both positive and negative controls for inflammatory stimuli

  • Temporal analysis:

    • Study developmental time course of Tmem232 expression

    • Analyze acute vs. chronic inflammatory responses

    • Investigate age-dependent effects on both phenotypes

  • Combinatorial approaches:

    • Combine in vivo phenotypic analysis with in vitro mechanistic studies

    • Use complementary techniques to validate findings (e.g., RNA-seq, proteomics)

    • Incorporate systems biology approaches to model pathway interactions

  • Translational components:

    • Include human samples where available

    • Develop in vitro models using human cells

    • Consider species differences in experimental design and interpretation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.