Recombinant Rat Transmembrane protein 33 (Tmem33)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Rat Transmembrane protein 33 (Tmem33) is a protein expressed in cell-free systems and is also known as transmembrane protein 33 isoform 1 . It has a purity level of greater than or equal to 85%, as determined by SDS-PAGE . Tmem33 is associated with the gene name Tmem33 and the synonym Db83 .

Forms and Availability

Tmem33 is available in recombinant forms for various species, including rat, mouse, human, and Dictyostelium discoideum . These recombinant proteins are often expressed in host systems such as E. coli, yeast, baculovirus, or mammalian cells .

Characteristics

CharacteristicDescription
Gene NamesTmem33; Db83 (Rat)
Other NamesTransmembrane protein 33 isoform 1; transmembrane protein 33 (Rat)
Host/ReactivitiesCell-Free Expression (Rat)
PurityGreater or equal to 85% purity as determined by SDS-PAGE
SynonymsDb83
Protein NamesTransmembrane protein 33, Protein DB83
Expression Region1-247 (Rat)

Function and Significance

TMEM33 is an endoplasmic reticulum (ER) transmembrane protein involved in the unfolded protein response (UPR) . It acts as a regulator of the PERK-eIF2α-ATF4 and IRE1-XBP1 axes of the UPR signaling pathways . When ER stress occurs, TMEM33 expression increases, influencing apoptosis, autophagy, oncogenesis, metastasis, and resistance to cancer therapies .

  • Role in UPR Signaling: TMEM33 interacts with PERK and affects the expression of proteins involved in ER stress response, such as p-eIF2α, p-IRE1α, ATF4, and XBP1-S .

  • Impact on Apoptosis and Autophagy: Overexpression of TMEM33 correlates with increased apoptotic signals (cleaved caspase-7 and cleaved PARP), the autophagosome protein LC3II, and reduced expression of the autophagy marker p62 .

  • Potential as an Anti-malarial Target: It has been shown that TMEM33 is crucial for all life cycle stages of the malaria parasite .

Research Findings

  • A study showed that TMEM33 is a novel ER stress-inducible and ER transmembrane molecule, and a new binding partner of PERK .

  • Data indicates that TMEM33 overexpression can lead to increased expression levels of p-eIF2α and p-IRE1α, as well as their downstream effectors, ATF4 and XBP1-S, in breast cancer cells .

  • TMEM33 may function as a determinant of ER stress-responsive events in cancer cells .

  • Research suggests that TMEM33 is essential for the development of all life cycle stages of the malaria parasite, which indicates its potential as an anti-malarial target .

  • Induced interleukin-33 expression enhances the tumorigenic activity .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Tmem33; Db83; Transmembrane protein 33; Protein DB83
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Tmem33
Target Protein Sequence
MADTTPNGPQGAGAVQFMMTNKLDTAMWLSRLFTVYCSALFVLPLLGLHEAASFYQRALL ANALTSALRLHQRLPHFQLSRAFLAQALLEDSCHYLLYSLIFVNSYPVTMSIFPVLLFSL LHAATYTKKVLDAKGSNSLPLLRSVLDKLSTNQQNILKFIACNEIFLMPATVFMLFSGQG SLLQPFIYYRFLTLRYSSRRNPYCRNLFNELRIVVEHIIMKPSCPLFVRRLCLQSIAFIS RLAPTVA
Uniprot No.

Target Background

Function

Recombinant Rat Transmembrane protein 33 (Tmem33) acts as a regulator of the tubular endoplasmic reticulum (ER) network. It suppresses RTN3/4-induced formation of ER tubules and positively regulates PERK-mediated and IRE1-mediated unfolded protein response signaling.

Database Links

KEGG: rno:59303

UniGene: Rn.203963

Protein Families
PER33/POM33 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Melanosome. Nucleus envelope.
Tissue Specificity
Highly expressed in the liver and significantly in brain, lungs and kidneys.

Q&A

Advanced Research Questions

  • How does Tmem33 regulate lipid homeostasis through the SCAP-SREBP pathway?

Tmem33 functions as a critical regulator of lipid homeostasis through its interaction with the SCAP-SREBP pathway. Research has demonstrated that Tmem33 negatively regulates activation of SREBP1 by recruiting the E3 ubiquitin ligase RNF5 .

Key Mechanism:

  • Tmem33 forms a tripartite complex with both SCAP and RNF5, which has been confirmed through co-immunoprecipitation experiments

  • This interaction facilitates the ubiquitination of SCAP, leading to its degradation

  • As a result, SREBP activation is inhibited, which reduces lipid synthesis

Experimental Validation:

  • Proximity ligation assays have confirmed direct interaction between TMEM33 and RNF5 in MDA-MB-231 cells

  • Both exogenous FLAG-tagged TMEM33 and endogenous TMEM33 co-immunoprecipitate with SCAP and RNF5

  • RNF5 levels positively correlate with TMEM33 expression levels in both overexpression and knockdown experiments

To investigate this pathway, researchers should design experiments that:

  • Manipulate Tmem33 expression through overexpression or knockdown

  • Monitor changes in lipid content using assays such as Oil Red O staining

  • Assess SREBP1 processing through nuclear/cytoplasmic fractionation and Western blotting

  • Measure the expression of SREBP target genes through qRT-PCR

  • Analyze SCAP ubiquitination through immunoprecipitation followed by ubiquitin Western blotting

  • What methodologies are effective for studying Tmem33's role in ER stress responses?

Tmem33 has been identified as a stress-inducible ER transmembrane protein that modulates the unfolded protein response (UPR) . To study its role in ER stress responses, researchers should employ the following methodologies:

Induction of ER Stress:

  • Chemical inducers: Thapsigargin (disrupts ER calcium homeostasis), Tunicamycin (inhibits N-glycosylation), or DTT (disrupts disulfide bonds)

  • Nutrient deprivation: Glucose starvation protocols

  • Hypoxia chambers: To simulate physiological stress conditions

Assessment of UPR Pathway Activation:

  • PERK Pathway: Monitor phosphorylation of eIF2α and expression of ATF4 and CHOP

  • IRE1α Pathway: Assess XBP1 splicing through RT-PCR and XBP1-S protein levels

  • ATF6 Pathway: Examine ATF6 cleavage and nuclear translocation

Experimental Design:

  • Overexpression studies: Exogenous expression of TMEM33 leads to increased phosphorylation of eIF2α and IRE1α, with subsequent upregulation of ATF4-CHOP and XBP1-S

  • Knockdown approaches: siRNA targeting Tmem33 to assess the effect on basal and stress-induced UPR signaling

  • Co-immunoprecipitation: To identify interactions between Tmem33 and UPR components, particularly its binding to PERK

  • Subcellular fractionation: To monitor changes in Tmem33 localization during ER stress

  • Cell viability assays: To determine the effect of Tmem33 manipulation on stress-induced apoptosis

Downstream Effect Analysis:

  • Monitor apoptotic markers (cleaved caspase-7, cleaved PARP) after Tmem33 modulation

  • Assess autophagy indicators (LC3II, p62) to examine the relationship between Tmem33 and autophagy induction

  • Analyze calcium flux using fluorescent calcium indicators to link Tmem33 to calcium homeostasis

  • How can researchers effectively investigate Tmem33's role in antiviral immunity?

Recent research has revealed that Tmem33 functions as a negative regulator of virus-triggered interferon (IFN) induction . To investigate this role, researchers should employ the following comprehensive approach:

Experimental Models:

  • Cell Culture Systems: Establish appropriate cell lines (both rat and human) for comparative studies

  • Animal Models: Consider using rat models or transgenic mice for in vivo investigations

  • Zebrafish Models: Utilize zebrafish as an alternative model given the extensive validation of Tmem33's antiviral role in this system

Expression Analysis:

  • Stimulation Experiments: Challenge cells with viral components (poly(I:C), 5'ppp-dsRNA) and monitor Tmem33 expression changes using qRT-PCR and Western blotting

  • Time-course Studies: Assess temporal dynamics of Tmem33 expression following viral stimulation

Mechanistic Investigations:

  • Co-localization Studies: Perform immunofluorescence to verify Tmem33 localization to the ER and potential interaction with antiviral signaling components

  • Protein-Protein Interactions: Conduct co-immunoprecipitation experiments to identify interactions with RLR cascade components

  • Ubiquitination Assays: Examine K48-linked ubiquitination of MAVS mediated by Tmem33

  • Phosphorylation Analysis: Monitor phosphorylation of TBK1, MITA/STING, and IRF3 in the presence or absence of Tmem33

Functional Studies:

  • Reporter Assays: Utilize IFN promoter reporter constructs to quantify the impact of Tmem33 on IFN production

  • Gene Knockdown: Use siRNA or CRISPR-Cas9 to reduce Tmem33 expression and assess effects on antiviral responses

  • Domain Mapping: Perform structure-function analysis focusing on the N-terminal transmembrane domains (TM1 and TM2) that have been shown to be necessary for IFN suppression

Viral Challenge Experiments:

  • Conduct infection studies with model viruses (e.g., vesicular stomatitis virus, Sendai virus)

  • Quantify viral replication in the presence of Tmem33 overexpression or knockdown

  • Measure production of type I IFNs and ISGs using ELISA and qRT-PCR

  • What are the optimal protocols for knockdown or knockout of Tmem33 in rat models?

siRNA-Mediated Knockdown

For transient knockdown of Tmem33 in rat models, siRNA represents an effective approach:

  • Design Considerations:

    • Target multiple regions of the Tmem33 transcript to enhance knockdown efficiency

    • Use at least 3-4 different siRNA constructs to increase chances of significant knockdown

    • Ensure specificity by BLAST analysis against the rat genome

  • Delivery Methods:

    • In vitro: Lipofectamine or similar transfection reagents for cell culture experiments

    • In vivo: Use hydrodynamic injection, lipid nanoparticles, or viral vectors (AAV) for liver-specific delivery

    • Consider tissue-specific delivery systems for targeted knockdown

  • Validation Protocol:

    • Confirm knockdown efficiency by qRT-PCR (mRNA level) and Western blotting (protein level)

    • Optimal assessment timepoint is 48-72 hours post-transfection

    • Target knockdown efficiency should exceed 70% for functional studies

CRISPR-Cas9 Knockout Strategies

For permanent knockout of Tmem33 in rat models:

  • gRNA Design:

    • Target early exons to ensure complete functional disruption

    • Design multiple gRNAs (at least 3) targeting different exons

    • Check for off-target effects using appropriate algorithms

  • Delivery Systems:

    • Cell Lines: Lentiviral or plasmid-based delivery

    • Rat Models: Embryo microinjection for germline modification

    • Tissue-Specific: AAV-based delivery with tissue-specific promoters

  • Validation Methods:

    • Genomic DNA PCR and sequencing to confirm mutation

    • Western blotting to verify complete protein knockout

    • Functional assays to assess phenotypic changes

Conditional Knockout Approaches

For temporal control of Tmem33 knockout:

  • Cre-loxP System:

    • Generate floxed Tmem33 rats by flanking critical exons with loxP sites

    • Cross with tissue-specific or inducible Cre lines (similar to the approach used for PKM conditional knockout)

    • Induce knockout by tamoxifen administration in inducible Cre models

  • Induction Protocol:

    • For tamoxifen-inducible systems: 100 μl of tamoxifen (10 mg/ml, suspended in corn oil) injected intraperitoneally every 2 days for five injections

    • Control groups should receive corn oil only

    • Validate knockout efficiency 7 days after the last injection

  • Phenotypic Analysis:

    • Conduct tissue-specific assays depending on research questions

    • For lipid metabolism studies, measure plasma cholesterol and LDL levels using appropriate assay kits

    • For ER stress studies, analyze tissue expression of UPR markers

  • How can researchers design experiments to elucidate the functional domains of Tmem33?

Determining the functional domains of Tmem33 requires systematic structure-function analysis. Based on previous studies with zebrafish TMEM33, researchers should focus on the transmembrane domains which appear critical for function .

Domain Mapping Strategy:

  • Truncation Constructs:

    • Generate a series of systematic truncation mutants of Tmem33

    • Include constructs targeting:

      • N-terminal region

      • Individual transmembrane domains (TM1, TM2, TM3)

      • C-terminal region

    • Express each construct with appropriate tags (e.g., Flag, HA, Halo) for detection and purification

  • Point Mutation Analysis:

    • Identify conserved residues within each domain through sequence alignment across species

    • Create point mutations at these conserved sites

    • Focus particularly on the N-terminal transmembrane domains (TM1 and TM2) which have been shown to be necessary for function in zebrafish studies

  • Fusion Protein Approaches:

    • Generate domain-swapping constructs with related proteins

    • Create chimeric proteins to identify functional compatibility

Functional Assay Systems:

  • Protein-Protein Interaction Analysis:

    • Perform co-immunoprecipitation with each construct to identify interaction domains

    • Use the T7 Quick Coupled Translation/Transcription system for in vitro protein-protein interaction assays

    • Conduct binding assays in appropriate buffer conditions (1X PBS, 0.1% NP-40, 0.5 mM DTT, 10% glycerol, 1mM PMSF)

  • Localization Studies:

    • Conduct subcellular fractionation and immunofluorescence to determine localization requirements

    • Examine co-localization with ER markers and potential interaction partners

  • Functional Readouts:

    • For antiviral function: IFN promoter activity assays with each construct

    • For ER stress responses: Monitor UPR marker activation

    • For lipid metabolism: Assess SREBP processing and target gene expression

Experimental Protocol Example (for mapping TMEM33 domains that interact with SCAP):

  • Generate Halo-tagged TMEM33-HA and various truncation constructs

  • Express constructs in HEK293T cells

  • Enrich TMEM33 and truncations using Halo Tag beads

  • Release proteins using TEV cleavage enzyme

  • Analyze interactions by SDS-PAGE and Western blotting

  • How does Tmem33 contribute to cancer progression and what experimental approaches can elucidate its mechanisms?

TMEM33 has been implicated in cancer progression, particularly in cervical squamous cell carcinoma and endocervical adenocarcinoma (CESC), with high expression predicting poor prognosis . Researchers investigating Tmem33's role in cancer should consider the following comprehensive experimental approaches:

Mechanistic Studies:

  • Pathway Analysis:

    • Perform GO, KEGG, and GSEA analyses to identify enriched pathways

    • Focus on immune responses, signal transduction, and lipid metabolism pathways

    • Develop experimental validation of key pathways identified through bioinformatics

  • Protein-Protein Interaction Analysis:

    • Utilize STRING database to identify TMEM33-binding proteins

    • Consider common molecules between interacted genes and similar genes, such as RNF4

    • Experimentally validate interactions using co-immunoprecipitation and proximity ligation assays

  • Immune Infiltration Analysis:

    • Apply ssGSEA method to determine the correlation between TMEM33 and immune cell infiltration

    • Focus on cell types showing significant correlation (T helper cells, Eosinophils, Th1 cells, Treg)

    • Validate correlations through immunohistochemistry and flow cytometry

Functional Validation:

  • In Vitro Approaches:

    • Generate stable TMEM33 knockdown and overexpression in cancer cell lines

    • Assess proliferation, migration, invasion, and colony formation

    • Examine effects on ER stress responses and lipid metabolism

    • Analyze changes in apoptotic markers (cleaved caspase-7, cleaved PARP)

  • In Vivo Models:

    • Develop xenograft models with TMEM33 modulation

    • Consider adenoviral delivery for overexpression studies (10^9 active viral particles)

    • Assess tumor growth, metastasis, and responsiveness to therapy

    • Examine tumor microenvironment changes, particularly immune cell infiltration

Analytical Techniques:

  • Transcriptomic Analysis:

    • RNA-sequencing to identify differentially expressed genes following TMEM33 modulation

    • Focus on pathways related to ER stress, lipid metabolism, and immune responses

  • Imaging Studies:

    • Immunohistochemistry to assess TMEM33 expression in tumor tissues

    • Consider multiplex immunofluorescence to simultaneously visualize TMEM33 and immune markers

  • Statistical Approaches:

    • Employ univariate and multivariate Cox regression analysis for survival studies

    • Use Spearman's correlation for immune infiltration analysis

    • Consider a threshold of p < 0.05 for statistical significance

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.